DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mahe and Hel25E

DIOPT Version :9

Sequence 1:NP_001284994.1 Gene:mahe / 31707 FlyBaseID:FBgn0029979 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_723089.1 Gene:Hel25E / 33781 FlyBaseID:FBgn0014189 Length:424 Species:Drosophila melanogaster


Alignment Length:428 Identity:117/428 - (27%)
Similarity:202/428 - (47%) Gaps:58/428 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 EIRRELEIT-VSGNELPHPVV----------SFEESSLPAHVIEEMKRQGFTKPTAIQSQGWPIA 271
            |...:.|.| |...|.|...|          .|.:..|...::..:...||..|:.:|.:..|.|
  Fly    11 EDEEQTETTAVENQEAPKKDVKGTYVSIHSSGFRDFLLKPEILRAIVDCGFEHPSEVQHECIPQA 75

  Fly   272 LSGRDLVGIAQTGSGKTLAYMLPAI----------VHIGNQPPIIRGEGPIALVLAPTRELAQQI 326
            :.|.|::..|::|.|||..::|..:          .|:              ||:..|||||.||
  Fly    76 VLGMDILCQAKSGMGKTAVFVLATLQQLEPSDNNTCHV--------------LVMCHTRELAFQI 126

  Fly   327 QSVVRDYGHLCK--PEIRHTCIFGGSSKVPQARDLDRGV-EVIIATPGRLIDFLENRNTNLQRCT 388
            .   ::|....|  |.::....|||.:.......|..|. .:::.||||::..:.|:..||:...
  Fly   127 S---KEYERFSKYMPTVKVAVFFGGMAIQKDEETLKSGTPHIVVGTPGRILALIRNKKLNLKLLK 188

  Fly   389 YLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQVVMWSATWPKEVQALAGDFLNDYIQINIGSMNL 452
            :.||||.|:||: :.....:::|.......:||:|:|||..|:::.:...|:.|.:::.:.....
  Fly   189 HFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSKDIRPVCKKFMQDPMEVYVDDEAK 253

  Fly   453 SANHNIRQIVEICTEIEKPQRLVCLLNEISPIKNSGNNGNKIIVFVETKIKVEDILQIIRAEGYN 517
            ...|.::|......|.||.::|..||:.:        ..|::::||::..:...:.|::..:.:.
  Fly   254 LTLHGLQQHYVNLKENEKNKKLFELLDVL--------EFNQVVIFVKSVQRCVALSQLLTEQNFP 310

  Fly   518 ATSIHGDKTQNERDSVLKDFRNGKSNILIATDVASRGLDVEDLQYVINYDYPNSSENYVHRIGRT 582
            |..||...||.||.:..:.|::.:..||:||::..||:|:|.:..|.|||.|..|:.|:||:.|.
  Fly   311 AIGIHRGMTQEERLNRYQQFKDFQKRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARA 375

  Fly   583 GRCQQLGTAYTFFTPDN-AKQAREL-------ISVLEE 612
            ||....|.|.||.:.:| ||...|:       ||.|.|
  Fly   376 GRFGTKGLAITFVSDENDAKILNEVQDRFDVNISELPE 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maheNP_001284994.1 PTZ00110 136..656 CDD:240273 117/428 (27%)
DEADc 239..446 CDD:238167 58/220 (26%)
HELICc 457..594 CDD:238034 41/136 (30%)
Hel25ENP_723089.1 DEADc_DDX39 40..248 CDD:350708 58/224 (26%)
SF2_C_DEAD 259..388 CDD:350174 42/136 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.