powered by:
Protein Alignment Ykt6 and VAMP8
DIOPT Version :9
Sequence 1: | NP_572423.1 |
Gene: | Ykt6 / 31706 |
FlyBaseID: | FBgn0260858 |
Length: | 199 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_003752.2 |
Gene: | VAMP8 / 8673 |
HGNCID: | 12647 |
Length: | 100 |
Species: | Homo sapiens |
Alignment Length: | 54 |
Identity: | 17/54 - (31%) |
Similarity: | 33/54 - (61%) |
Gaps: | 0/54 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 138 DPLTKMQNDLDETKIILKNTIEAVLERGEKLDDMVSKSEKLSLQSKAFYKTAKK 191
|.:..:|::::..|.|:...:|.:|.|||.|:.:.:|:|.|...|:.|..|::|
Human 11 DRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQK 64
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5143 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.