DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ykt6 and YKT6

DIOPT Version :9

Sequence 1:NP_572423.1 Gene:Ykt6 / 31706 FlyBaseID:FBgn0260858 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_012725.1 Gene:YKT6 / 853638 SGDID:S000001679 Length:200 Species:Saccharomyces cerevisiae


Alignment Length:197 Identity:88/197 - (44%)
Similarity:131/197 - (66%) Gaps:2/197 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VKLFALSIFHKGASEARLLKTASDLQSFSFFQRGTVNEFMTFASKTIVERTQPALRQSVKQDAYM 66
            ::::.:.:|..|..:|..|....||..|.||:|.:|.:||||.::|:..||....|||:::..|:
Yeast     1 MRIYYIGVFRSGGEKALELSEVKDLSQFGFFERSSVGQFMTFFAETVASRTGAGQRQSIEEGNYI 65

  Fly    67 CHVYVRADNLAGVLIADHEYPHRVAHTLITKILDDFTAKVSADQWPNGTEA--TISFDLLPAFLA 129
            .|||.|::.:.||||.|.|||.|.|:||:.||||::......::|.:.||.  .:....|..:::
Yeast    66 GHVYARSEGICGVLITDKEYPVRPAYTLLNKILDEYLVAHPKEEWADVTETNDALKMKQLDTYIS 130

  Fly   130 RYQNPVEADPLTKMQNDLDETKIILKNTIEAVLERGEKLDDMVSKSEKLSLQSKAFYKTAKKTNS 194
            :||:|.:||.:.|:|.:||||||:|..|||.||:||||||::|.|||.|:..||.|||.|||:||
Yeast   131 KYQDPSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKKSNS 195

  Fly   195 CC 196
            ||
Yeast   196 CC 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ykt6NP_572423.1 SNC1 4..196 CDD:227472 86/193 (45%)
YKT6NP_012725.1 SNC1 3..200 CDD:227472 88/195 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345194
Domainoid 1 1.000 72 1.000 Domainoid score I2233
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4778
Inparanoid 1 1.050 187 1.000 Inparanoid score I928
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53588
OrthoFinder 1 1.000 - - FOG0004435
OrthoInspector 1 1.000 - - oto99673
orthoMCL 1 0.900 - - OOG6_101684
Panther 1 1.100 - - LDO PTHR45806
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1932
SonicParanoid 1 1.000 - - X3142
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.