DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ykt6 and ATYKT62

DIOPT Version :9

Sequence 1:NP_572423.1 Gene:Ykt6 / 31706 FlyBaseID:FBgn0260858 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001318826.1 Gene:ATYKT62 / 835930 AraportID:AT5G58180 Length:199 Species:Arabidopsis thaliana


Alignment Length:209 Identity:87/209 - (41%)
Similarity:115/209 - (55%) Gaps:25/209 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VKLFALSIFHKGASEAR---LLKTASDLQSFS--FFQRGTVNEFMTFASKTIVERTQPALRQSVK 61
            :|:.||.:. |...|.|   :|...|||..|.  .|.|....||:.|.::|:..||.|..|||||
plant     1 MKITALLVL-KCDPETREPVILANVSDLSQFGKFSFYRSNFEEFIVFIARTVARRTPPGQRQSVK 64

  Fly    62 QDAYMCHVYVRADNLAGVLIADHEYPHRVAHTLITKILDDFTA--------KVSADQWPNGTEAT 118
            .:.|..|.| ..:.|..|...|..||.|.|.:|:.::||.:..        :.|:..||...||:
plant    65 HEEYKVHAY-NINGLCAVGFMDDHYPVRSAFSLLNQVLDVYQKDYGDTWRFENSSQPWPYLKEAS 128

  Fly   119 ISFDLLPAFLARYQNPVEADPLTKMQNDLDETKIILKNTIEAVLERGEKLDDMVSKSEKLSLQSK 183
                      .::::|.|||.|.|:|.:||||||||..||:.||.||||||.:|.||.:|||.||
plant   129 ----------DKFRDPAEADKLLKIQRELDETKIILHKTIDGVLARGEKLDSLVEKSSELSLASK 183

  Fly   184 AFYKTAKKTNSCCS 197
            .|||.||||||||:
plant   184 MFYKQAKKTNSCCT 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ykt6NP_572423.1 SNC1 4..196 CDD:227472 84/204 (41%)
ATYKT62NP_001318826.1 SNC1 1..196 CDD:227472 85/206 (41%)
R-SNARE_YKT6 137..197 CDD:277220 41/59 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3102
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I1653
OMA 1 1.010 - - QHG53588
OrthoDB 1 1.010 - - D1362424at2759
OrthoFinder 1 1.000 - - FOG0004435
OrthoInspector 1 1.000 - - otm3407
orthoMCL 1 0.900 - - OOG6_101684
Panther 1 1.100 - - O PTHR45806
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3142
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.