DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ykt6 and Sec22c

DIOPT Version :9

Sequence 1:NP_572423.1 Gene:Ykt6 / 31706 FlyBaseID:FBgn0260858 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_038938688.1 Gene:Sec22c / 687022 RGDID:1590146 Length:306 Species:Rattus norvegicus


Alignment Length:145 Identity:30/145 - (20%)
Similarity:53/145 - (36%) Gaps:39/145 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RTQPALRQSVKQ-----DAYMCH---VYVRADNLAGVLIADHEYPHRVAHTLITKILDDFTAKVS 107
            |...||.|.:.|     .|..|.   .::.:.::|.:.|...:.|..:|...:..:..||.|   
  Rat    35 RQLKALAQRLAQHPGRGSAESCDFRIYFLSSGDVACMAICSRQCPAAMAFCFLEALWWDFIA--- 96

  Fly   108 ADQWPNGTEATISFDLLPAFLARYQNPVEADPLTKMQND--LDETKIILKNTIEAVLERG-EKLD 169
                        |:|.....||       :.|.|.::.|  :.:||....:...:.::.| ||: 
  Rat    97 ------------SYDTTCIGLA-------SRPYTFLEFDSVIQKTKWHFNHMSSSQMKSGLEKI- 141

  Fly   170 DMVSKSEKLSLQSKA 184
                 .|:|..|..|
  Rat   142 -----QEELKSQPPA 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ykt6NP_572423.1 SNC1 4..196 CDD:227472 30/145 (21%)
Sec22cXP_038938688.1 Longin 5..123 CDD:341428 21/109 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.