DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ykt6 and sec22b

DIOPT Version :9

Sequence 1:NP_572423.1 Gene:Ykt6 / 31706 FlyBaseID:FBgn0260858 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_989156.1 Gene:sec22b / 394761 XenbaseID:XB-GENE-999421 Length:215 Species:Xenopus tropicalis


Alignment Length:189 Identity:39/189 - (20%)
Similarity:75/189 - (39%) Gaps:41/189 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KTASDLQSF-----SFFQRGTVNEFMTFASKTIVERTQPALRQSVKQDAYMCHVYVRADNLAGVL 80
            ::..|||.:     ..|::  :||             |...|.:::..|...| |:....:..::
 Frog    25 QSGRDLQQYQNQAKQLFRK--LNE-------------QSPTRCTLEAGAMTFH-YLIEKGVCYLV 73

  Fly    81 IADHEYPHRVAHTLITKILDDFTAKVSADQWPNGTEATISFDLLPAFLARYQNPVEADP------ 139
            :.:..:|.::|...:..:..:|      |:.......|:|   .|.....:.|.::...      
 Frog    74 LCEAAFPKKLAFAYLEDLFSEF------DEQHGKKVPTVS---RPYSFIEFDNYIQKTKKSYIDS 129

  Fly   140 -----LTKMQNDLDETKIILKNTIEAVLERGEKLDDMVSKSEKLSLQSKAFYKTAKKTN 193
                 |:.:..:|.:.:.|:...||.||.|||.|..:.||:..||..||.:.:.||..|
 Frog   130 RARRNLSSVNTELQDVQRIMVANIEEVLLRGEALSALDSKASNLSTLSKKYRQDAKYLN 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ykt6NP_572423.1 SNC1 4..196 CDD:227472 39/189 (21%)
sec22bNP_989156.1 Longin 3..126 CDD:341428 19/125 (15%)
R-SNARE_SEC22 132..195 CDD:277219 20/57 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.