DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ykt6 and ykt6

DIOPT Version :9

Sequence 1:NP_572423.1 Gene:Ykt6 / 31706 FlyBaseID:FBgn0260858 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_989023.1 Gene:ykt6 / 394619 XenbaseID:XB-GENE-949728 Length:198 Species:Xenopus tropicalis


Alignment Length:195 Identity:113/195 - (57%)
Similarity:156/195 - (80%) Gaps:0/195 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VKLFALSIFHKGASEARLLKTASDLQSFSFFQRGTVNEFMTFASKTIVERTQPALRQSVKQDAYM 66
            :||::||:.:||.::..|||:|.|:.|||||||.::.|||.|.|:.||||:....|.|||:..|:
 Frog     1 MKLYSLSVLYKGDNKVSLLKSAYDVSSFSFFQRSSIQEFMAFTSQLIVERSDKGSRSSVKEQEYL 65

  Fly    67 CHVYVRADNLAGVLIADHEYPHRVAHTLITKILDDFTAKVSADQWPNGTEATISFDLLPAFLARY 131
            ||||||.|:||||:|||:|||.||..||:.|:|::|:.:|....||:|:.|||.::.|.::|::|
 Frog    66 CHVYVRNDSLAGVVIADNEYPPRVCFTLLEKVLEEFSTQVDRIDWPSGSPATIQYNALDSYLSKY 130

  Fly   132 QNPVEADPLTKMQNDLDETKIILKNTIEAVLERGEKLDDMVSKSEKLSLQSKAFYKTAKKTNSCC 196
            |||.:|||::|:|.:||||||||.||:|::|:|||||||:|||||.|..|||||||||:|.||||
 Frog   131 QNPRDADPMSKVQAELDETKIILHNTMESLLQRGEKLDDLVSKSEVLGTQSKAFYKTARKQNSCC 195

  Fly   197  196
             Frog   196  195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ykt6NP_572423.1 SNC1 4..196 CDD:227472 110/191 (58%)
ykt6NP_989023.1 SNC1 3..198 CDD:227472 112/193 (58%)
R-SNARE_YKT6 136..195 CDD:277220 42/58 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I8017
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4778
Inparanoid 1 1.050 241 1.000 Inparanoid score I3246
OMA 1 1.010 - - QHG53588
OrthoDB 1 1.010 - - D1362424at2759
OrthoFinder 1 1.000 - - FOG0004435
OrthoInspector 1 1.000 - - oto103923
Panther 1 1.100 - - LDO PTHR45806
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1932
SonicParanoid 1 1.000 - - X3142
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.