DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ykt6 and ykt6

DIOPT Version :9

Sequence 1:NP_572423.1 Gene:Ykt6 / 31706 FlyBaseID:FBgn0260858 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_957386.1 Gene:ykt6 / 394067 ZFINID:ZDB-GENE-040426-733 Length:198 Species:Danio rerio


Alignment Length:195 Identity:121/195 - (62%)
Similarity:152/195 - (77%) Gaps:0/195 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VKLFALSIFHKGASEARLLKTASDLQSFSFFQRGTVNEFMTFASKTIVERTQPALRQSVKQDAYM 66
            :||::||:.|||:::|.|||...||.|||||||.:|.|||||.|..||||:....|.|||:..|:
Zfish     1 MKLYSLSVLHKGSTKANLLKATYDLSSFSFFQRSSVQEFMTFTSALIVERSALGSRASVKEQEYL 65

  Fly    67 CHVYVRADNLAGVLIADHEYPHRVAHTLITKILDDFTAKVSADQWPNGTEATISFDLLPAFLARY 131
            ||||||.|||.||:|||.|||.||..||:.|:||:|:.:|::..||:|:.|||.:..|.:.||||
Zfish    66 CHVYVRNDNLGGVVIADSEYPSRVCFTLLDKVLDEFSRQVNSIDWPSGSPATIQYTALDSHLARY 130

  Fly   132 QNPVEADPLTKMQNDLDETKIILKNTIEAVLERGEKLDDMVSKSEKLSLQSKAFYKTAKKTNSCC 196
            |||.|||.:||:|.:||||||||.||:|::|||||||||:|.|||.|..|||||||||:|.||||
Zfish   131 QNPREADAMTKVQAELDETKIILHNTMESLLERGEKLDDLVQKSEHLGNQSKAFYKTARKQNSCC 195

  Fly   197  196
            Zfish   196  195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ykt6NP_572423.1 SNC1 4..196 CDD:227472 118/191 (62%)
ykt6NP_957386.1 SNC1 3..198 CDD:227472 120/193 (62%)
Longin 44..104 CDD:290490 35/59 (59%)
R-SNARE_YKT6 136..195 CDD:277220 42/58 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590058
Domainoid 1 1.000 84 1.000 Domainoid score I8261
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4778
Inparanoid 1 1.050 247 1.000 Inparanoid score I3243
OMA 1 1.010 - - QHG53588
OrthoDB 1 1.010 - - D1362424at2759
OrthoFinder 1 1.000 - - FOG0004435
OrthoInspector 1 1.000 - - oto39156
orthoMCL 1 0.900 - - OOG6_101684
Panther 1 1.100 - - LDO PTHR45806
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3142
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.