DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ykt6 and sec22bb

DIOPT Version :9

Sequence 1:NP_572423.1 Gene:Ykt6 / 31706 FlyBaseID:FBgn0260858 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001315455.1 Gene:sec22bb / 327277 ZFINID:ZDB-GENE-030131-5488 Length:219 Species:Danio rerio


Alignment Length:187 Identity:42/187 - (22%)
Similarity:77/187 - (41%) Gaps:35/187 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KTASDLQSF-----SFFQRGTVNEFMTFASKTIVERTQPALRQSVKQDAYMCHVYVRADNLAGVL 80
            |...|||.:     ..|::  :||             |...|.:::..:...| ||....:..::
Zfish    29 KMGRDLQQYQSQAKQLFRK--LNE-------------QSPNRCTLEAGSMSFH-YVIEKGVCYLV 77

  Fly    81 IADHEYPHRVAHTLITKILDDF----TAKVSADQWPNGTEATISFDLLPAFLAR----YQNPVEA 137
            :.:..:|.::|...:..:..:|    ..||.....|   .:.|.||   .::.:    |.:....
Zfish    78 LCEAGFPKKLAFAYLEDLQAEFHEQHGKKVPTVSRP---YSFIEFD---TYIQKTKKSYIDSRAR 136

  Fly   138 DPLTKMQNDLDETKIILKNTIEAVLERGEKLDDMVSKSEKLSLQSKAFYKTAKKTNS 194
            ..|:.:..:|.:.:.|:...||.||:|||.|..:.||:..||..||.:...||..|:
Zfish   137 RNLSNINTELQDVQRIMVANIEEVLQRGEALSALDSKASNLSSLSKKYRSDAKYLNT 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ykt6NP_572423.1 SNC1 4..196 CDD:227472 42/187 (22%)
sec22bbNP_001315455.1 SNC1 12..192 CDD:227472 41/184 (22%)
Longin 41..107 CDD:290490 11/81 (14%)
R-SNARE_SEC22 136..199 CDD:277219 20/58 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.