DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ykt6 and Sec22a

DIOPT Version :9

Sequence 1:NP_572423.1 Gene:Ykt6 / 31706 FlyBaseID:FBgn0260858 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_006522298.1 Gene:Sec22a / 317717 MGIID:2447876 Length:323 Species:Mus musculus


Alignment Length:81 Identity:14/81 - (17%)
Similarity:35/81 - (43%) Gaps:4/81 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RQSVKQDAYMCHVYVRADNLAGVLIADHEYPHRVAHTLITKILDDFTAKVSADQWPNGTE--ATI 119
            |.::|...|..: ::.:..::.:::....||:.:|.:.:.::..:|....:..:......  ..|
Mouse    66 RCTLKTGRYNIN-FISSLGVSYMMLCSENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFI 129

  Fly   120 SFD-LLPAFLARYQNP 134
            .|| .:.....||.||
Mouse   130 EFDNFIQRTKQRYNNP 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ykt6NP_572423.1 SNC1 4..196 CDD:227472 14/81 (17%)
Sec22aXP_006522298.1 Longin 21..142 CDD:341428 10/76 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.