DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ykt6 and Sec22

DIOPT Version :9

Sequence 1:NP_572423.1 Gene:Ykt6 / 31706 FlyBaseID:FBgn0260858 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001259103.1 Gene:Sec22 / 31030 FlyBaseID:FBgn0260855 Length:213 Species:Drosophila melanogaster


Alignment Length:148 Identity:36/148 - (24%)
Similarity:73/148 - (49%) Gaps:13/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TQPALRQSVKQDAYMCHVYVRADNLAGVLIADHEYPHRVAHTLITKILDDFTA----KVSADQWP 112
            |....|.|::...|:.| |:..:::..:::.|..|..|:|...:..:..:|.|    :|::...|
  Fly    48 THSPARCSIETGPYLFH-YLIENDVCYLVMVDKMYSKRLAFNYLEDLAQEFHANYGRRVNSVTRP 111

  Fly   113 NGTEATISFDLLPAFL--ARYQNPVEADPLTKMQNDLDETKIILKNTIEAVLERGEKLDDMVSKS 175
               .|.|.||:   ::  |:.|.......::.:...|.:.:.|:...|:.||:||..|.::.:|:
  Fly   112 ---YAFIEFDV---YIQKAKKQLTDRRRNISNINTQLQDVQRIMVQNIDDVLQRGTVLAELDTKT 170

  Fly   176 EKLSLQSKAFYKTAKKTN 193
            :.||:.|:.:.|.||..|
  Fly   171 QNLSMMSQKYKKDAKLLN 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ykt6NP_572423.1 SNC1 4..196 CDD:227472 36/148 (24%)
Sec22NP_001259103.1 SNC1 10..192 CDD:227472 36/148 (24%)
Longin 39..105 CDD:290490 12/57 (21%)
R-SNARE_SEC22 132..195 CDD:277219 16/57 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448295
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.