powered by:
Protein Alignment Ykt6 and Sec22c
DIOPT Version :9
Sequence 1: | NP_572423.1 |
Gene: | Ykt6 / 31706 |
FlyBaseID: | FBgn0260858 |
Length: | 199 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001158034.1 |
Gene: | Sec22c / 215474 |
MGIID: | 2447871 |
Length: | 303 |
Species: | Mus musculus |
Alignment Length: | 101 |
Identity: | 22/101 - (21%) |
Similarity: | 36/101 - (35%) |
Gaps: | 34/101 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 LAGVLIADHEYPHRVAHTLITKILDDFTAKVS----------------------------ADQWP 112
:.||.:|:|.. :||...:..||..|...|: .:.:.
Mouse 204 IRGVHLAEHSL--QVAQEEVGNILAFFIPSVACIVQCYLYLFYSPARTLKVLLMLASICLGNAYL 266
Fly 113 NGTEAT--ISFDLLPAFLARYQNPVEADPLTKMQND 146
:|...| |.|.:..|||:.|| :....|.:.|:|
Mouse 267 HGLRNTWQILFHVGVAFLSSYQ--ILTRQLQERQSD 300
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ykt6 | NP_572423.1 |
SNC1 |
4..196 |
CDD:227472 |
22/101 (22%) |
Sec22c | NP_001158034.1 |
Longin |
5..123 |
CDD:341428 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5143 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.