DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ykt6 and Sec22b

DIOPT Version :9

Sequence 1:NP_572423.1 Gene:Ykt6 / 31706 FlyBaseID:FBgn0260858 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_035472.1 Gene:Sec22b / 20333 MGIID:1338759 Length:215 Species:Mus musculus


Alignment Length:186 Identity:42/186 - (22%)
Similarity:77/186 - (41%) Gaps:35/186 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KTASDLQSF-----SFFQRGTVNEFMTFASKTIVERTQPALRQSVKQDAYMCHVYVRADNLAGVL 80
            ::..|||.:     ..|::  :||             |...|.:::..|...| |:....:..::
Mouse    25 QSGRDLQQYQSQAKQLFRK--LNE-------------QSPTRCTLEAGAMTFH-YIIEQGVCYLV 73

  Fly    81 IADHEYPHRVAHTLITKILDDFT----AKVSADQWPNGTEATISFDLLPAFLAR----YQNPVEA 137
            :.:..:|.::|...:..:..:|.    .||.....|   .:.|.||   .|:.:    |.:....
Mouse    74 LCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRP---YSFIEFD---TFIQKTKKLYIDSRAR 132

  Fly   138 DPLTKMQNDLDETKIILKNTIEAVLERGEKLDDMVSKSEKLSLQSKAFYKTAKKTN 193
            ..|..:..:|.:.:.|:...||.||:|||.|..:.||:..||..||.:.:.||..|
Mouse   133 RNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLN 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ykt6NP_572423.1 SNC1 4..196 CDD:227472 42/186 (23%)
Sec22bNP_035472.1 Longin 3..126 CDD:341428 21/122 (17%)
R-SNARE_SEC22 132..195 CDD:277219 20/57 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.