DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ykt6 and sec-22

DIOPT Version :9

Sequence 1:NP_572423.1 Gene:Ykt6 / 31706 FlyBaseID:FBgn0260858 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_508198.1 Gene:sec-22 / 180456 WormBaseID:WBGene00018853 Length:214 Species:Caenorhabditis elegans


Alignment Length:150 Identity:34/150 - (22%)
Similarity:66/150 - (44%) Gaps:21/150 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PALRQSVKQDAYMCHVYVRADNLAGVLIADHEYPHRVAHTLITKILDDFTAKVSADQWPNGTEAT 118
            || :|||:...::.| |:...|:..:::.|..:|.:||...::.|..:|.         |...:.
 Worm    49 PA-QQSVESGPFVFH-YIIVQNICALVLCDRNFPRKVAFQYLSDIGQEFL---------NENSSR 102

  Fly   119 ISFDLLPAFLARYQNPVE----------ADPLTKMQNDLDETKIILKNTIEAVLERGEKLDDMVS 173
            |...:.|.....:...::          ...:..:.|:|.:...|:...||.|:.|||.|:.:.:
 Worm   103 IEQVVRPYHFLEFDKYIQQAKQRYGDTNKHAMNTVSNELQDVTRIMVTNIEDVIHRGEALNILEN 167

  Fly   174 KSEKLSLQSKAFYKTAKKTN 193
            ::.:||..||.:...||..|
 Worm   168 RASELSGMSKKYRDDAKALN 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ykt6NP_572423.1 SNC1 4..196 CDD:227472 33/149 (22%)
sec-22NP_508198.1 Longin 38..103 CDD:290490 15/64 (23%)
R-SNARE_SEC22 131..194 CDD:277219 16/56 (29%)
Synaptobrevin 134..214 CDD:279324 16/53 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.