powered by:
Protein Alignment Ykt6 and Sec22a
DIOPT Version :9
Sequence 1: | NP_572423.1 |
Gene: | Ykt6 / 31706 |
FlyBaseID: | FBgn0260858 |
Length: | 199 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_476488.2 |
Gene: | Sec22a / 117513 |
RGDID: | 621659 |
Length: | 307 |
Species: | Rattus norvegicus |
Alignment Length: | 68 |
Identity: | 11/68 - (16%) |
Similarity: | 29/68 - (42%) |
Gaps: | 3/68 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 YVRADNLAGVLIADHEYPHRVAHTLITKILDDFTAKVSADQWPNGTE--ATISFD-LLPAFLARY 131
::.:..::.:::....||:.:|.:.:.::..:|....:..:...... ..|.|| .:.....||
Rat 62 FISSLGVSYMMLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQRTKQRY 126
Fly 132 QNP 134
.||
Rat 127 NNP 129
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5143 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.