DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hdm and AT1G67623

DIOPT Version :10

Sequence 1:NP_572422.1 Gene:hdm / 31705 FlyBaseID:FBgn0029977 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_176929.1 Gene:AT1G67623 / 843084 AraportID:AT1G67623 Length:296 Species:Arabidopsis thaliana


Alignment Length:104 Identity:19/104 - (18%)
Similarity:35/104 - (33%) Gaps:45/104 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 VRQIYSRAEGELQDPSIHQFTAVLYG-------MVTKFDLDGLTSHVNRKCIACQQHIPRNLQDC 372
            ::|:.|....||.: ..::...:.||       :|.:..    |::|:.|| .|         ||
plant   159 IKQLMSTTMNELVE-FRYKIQKIRYGFWWSDNTVVEQLK----TAYVSEKC-KC---------DC 208

  Fly   373 A-----------------------SDACQQYFSLDNDEP 388
            .                       |.||:.|..::.:.|
plant   209 KTRMLLLVMNRGWYLFGDETDLDFSSACELYLYINRNFP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hdmNP_572422.1 None
AT1G67623NP_176929.1 FBOX 27..70 CDD:197608
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.