DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hdm and AT2G35280

DIOPT Version :10

Sequence 1:NP_572422.1 Gene:hdm / 31705 FlyBaseID:FBgn0029977 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_850243.1 Gene:AT2G35280 / 818095 AraportID:AT2G35280 Length:163 Species:Arabidopsis thaliana


Alignment Length:62 Identity:19/62 - (30%)
Similarity:28/62 - (45%) Gaps:23/62 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 LGLRAEDFERLAEREKSELKWRFLLKYFEVRLMIKKPVGVRNHLVIVVVDMQAIPLEKLVAN 482
            ||..|.|     ||         :||...:.|::|||:..|.||:|         ::|.:||
plant    44 LGASAND-----ER---------VLKTLNLALLVKKPLSCRKHLLI---------MKKCLAN 82

Return to query results.
Submit another query.