DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hdm and rpa1

DIOPT Version :9

Sequence 1:NP_572422.1 Gene:hdm / 31705 FlyBaseID:FBgn0029977 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_956105.2 Gene:rpa1 / 327491 ZFINID:ZDB-GENE-030912-3 Length:601 Species:Danio rerio


Alignment Length:42 Identity:12/42 - (28%)
Similarity:18/42 - (42%) Gaps:10/42 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 NIHLSDQTGTLVEARL----------AGHPAERILGLRAEDF 428
            ||.|.|.:|.:::..:          :|.|...|.|.|..||
Zfish   331 NIQLIDMSGRVIQLTMWGSDAETFDGSGQPILAIKGARLSDF 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hdmNP_572422.1 None
rpa1NP_956105.2 rpa1 3..597 CDD:273177 12/42 (29%)
RPA1N 8..102 CDD:239923
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..172
RPA1_DBD_A 173..275 CDD:239920
REPA_OB_2 292..388 CDD:293505 12/42 (29%)
Rep_fac-A_C 446..591 CDD:285809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.