DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hdm and R03H10.7

DIOPT Version :9

Sequence 1:NP_572422.1 Gene:hdm / 31705 FlyBaseID:FBgn0029977 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_494734.3 Gene:R03H10.7 / 187559 WormBaseID:WBGene00019859 Length:359 Species:Caenorhabditis elegans


Alignment Length:197 Identity:35/197 - (17%)
Similarity:71/197 - (36%) Gaps:44/197 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VSKSSPN----IFYDKMS--GTERGVLSLTIRDSPNHLTNCKCWGQRD--CVDEYAAMLQIGHVV 83
            :||..||    |.|.::|  .:.|......:.||......|..:|...  |..|    |::....
 Worm     8 ISKLRPNYSNFIIYGQISFIKSVRNASIFKVTDSDRDTIKCVAFGATGDWCNKE----LKLKQFC 68

  Fly    84 DIVGAKVMSIPFAAPGEQRYQPQATVSCALVVNEGSGYVVRHDNDDFGQITILQQLLHQPIRPLG 148
            .::|.||.      |.::.|.........::::......::.|.      |||.:|   |:.|  
 Worm    69 YVLGGKVQ------PIDKNYNIYPNDEFEIIISNPRDIEIKLDP------TILSRL---PVTP-- 116

  Fly   149 AVLKLADVRSGLGFPDKIITTNVNLLVVVAAVRPVRQIKRKLQGPLSEVQELLQCLEVIVIDASY 213
                :.:::..:.:      ..::..|.:...||....:::....:::...     :.|...||.
 Worm   117 ----IENLKESVNY------FKIHGRVTLMDTRPPHHYQKRFNFEITDFNG-----DTIACSASS 166

  Fly   214 PE 215
            ||
 Worm   167 PE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hdmNP_572422.1 None
R03H10.7NP_494734.3 RPA_2b-aaRSs_OBF_like 7..101 CDD:385638 20/102 (20%)
rpa1 <106..>355 CDD:273177 14/89 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.