DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snz and Snx20

DIOPT Version :9

Sequence 1:NP_001284993.1 Gene:snz / 31704 FlyBaseID:FBgn0029976 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_082116.1 Gene:Snx20 / 71607 MGIID:1918857 Length:313 Species:Mus musculus


Alignment Length:238 Identity:50/238 - (21%)
Similarity:77/238 - (32%) Gaps:90/238 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 RYVRQLTMAKGECEKNLAKFGW-------NGNYSSDIDLTLVEILNTAVGRRYFTLFLEPLKASA 443
            |.:.::..|:.| |:.::||..       .|::.||         ...|.|||..  .|.|:.:.
Mouse    72 RLLFEIASARIE-ERKVSKFVMYQVVVIQTGSFDSD---------KAVVERRYSD--FERLQKAL 124

  Fly   444 LIGFYLAVEEIKHAHKSASHQLGTE--------------IFYTYIRVPKSEIQIDKHER-KLIET 493
            |..|...:|::....|..:..|..|              :.|....|.:|...:|...| :|.|.
Mouse   125 LKRFGPELEDVAFPRKRLTGNLSAETICERRRELREYLRLLYAVRAVRRSREFLDFLTRPELREA 189

  Fly   494 F-------------LLGDAEP---------------------DIFYDIQR------------NVL 512
            |             |||.|.|                     ....|::|            ..|
Mouse   190 FGCLRAGQYARALELLGRALPLQEKLTAHCPSAAVPALCAALVCLRDLERPAEAFAVGERALRCL 254

  Fly   513 RTLE-EKYYPP---------FVLSDQYRQLKEALDSNEIADPT 545
            ||.| .:||.|         :.|...:..|:..||.|::..||
Mouse   255 RTRENHRYYAPLLDAMVRLAYALGKDFAALQSRLDENQLRRPT 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snzNP_001284993.1 PXA 142..299 CDD:280373
RGS_SNX25 422..531 CDD:188675 35/179 (20%)
PX_SNX25 645..788 CDD:132788
Nexin_C 882..987 CDD:285792
Snx20NP_082116.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..60
PX_domain 73..186 CDD:383026 25/124 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.