DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snz and snx27a

DIOPT Version :9

Sequence 1:NP_001284993.1 Gene:snz / 31704 FlyBaseID:FBgn0029976 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001038565.1 Gene:snx27a / 566205 ZFINID:ZDB-GENE-060503-371 Length:567 Species:Danio rerio


Alignment Length:323 Identity:52/323 - (16%)
Similarity:100/323 - (30%) Gaps:113/323 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 IAVDMVNRVTVHLEKI---------------RIAEARAAETNTPPVFSTNSY----------LAD 239
            |:|.....|..|.||.               |..|......|....||..::          |::
Zfish   168 ISVPTYKHVEQHSEKFVVYNVYMSGRQLCSKRYREFAILHQNLKREFSNYTFPKLPGKWPFSLSE 232

  Fly   240 EEKEM------EFLRKLCEIMVI--------------------------LLLP------------ 260
            ::.:.      |::.::|.:.:|                          :.||            
Zfish   233 QQLDARRRGLEEYMERVCSVRIIGESDIMQEFLSESNENHNGITDVELRIALPDKTTASVRVQKN 297

  Fly   261 ----RGYSLPPLKVLLSEIL-SYKIFFPMI-----KMLTAPDYINQKVVQNIETRLAAAAMSKRS 315
                :.|....:||.:..:: ||...|.:|     :.|...::.::..|||..:.:....::.|.
Zfish   298 STTDQVYQALVVKVGMDSMMASYFALFEVINHSFVRKLAPNEFPHKLYVQNYTSAVPGTCLTMRK 362

  Fly   316 YEYAASFED-----------------------FLKIINNSGNLEELSLIRKSIVNDLMHATTMQN 357
            :.::...||                       |:|..:.:..|::|:..||.       .|.:..
Zfish   363 WLFSTQEEDLLRDNPLALHYCFHQAQDDVKKGFIKAEDKAYQLQKLAEQRKM-------TTYLSL 420

  Fly   358 LQRAKGLD----PDHEDHSLSKSELTAAVRLKRYVRQLTMAKGECEKNLAKFGWNGNYSSDID 416
            |:..:|.:    |.....|..|..:..||.:|.:........|..|..:..|.|:.....|.|
Zfish   421 LRSCEGYNEVTFPHCPCDSRRKGHVITAVSMKHFKLHACTEDGTLENQVIMFEWSEMQRWDTD 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snzNP_001284993.1 PXA 142..299 CDD:280373 25/177 (14%)
RGS_SNX25 422..531 CDD:188675
PX_SNX25 645..788 CDD:132788
Nexin_C 882..987 CDD:285792
snx27aNP_001038565.1 PDZ_signaling 44..136 CDD:238492
PX_SNX27 163..268 CDD:132796 15/99 (15%)
SNX27_RA 277..363 CDD:176372 14/85 (16%)
FERM-like_C_SNX27 428..529 CDD:270146 12/56 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1370
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.