Sequence 1: | NP_001284993.1 | Gene: | snz / 31704 | FlyBaseID: | FBgn0029976 | Length: | 1117 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001038839.2 | Gene: | snx22 / 561624 | ZFINID: | ZDB-GENE-060825-154 | Length: | 220 | Species: | Danio rerio |
Alignment Length: | 128 | Identity: | 24/128 - (18%) |
---|---|---|---|
Similarity: | 50/128 - (39%) | Gaps: | 17/128 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 713 VMRSLNQVHELQRKLRHVSSNLKAIDLPTNFKFFFLKTDRHGQ----EKAKSQIQKFLNFILEDD 773
Fly 774 HLNGSEAIYTFLSPSSDH--LKQSLPSPKKSKFSLSTLFRSDAGKAHEASKATDPFWGLQRDD 834 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
snz | NP_001284993.1 | PXA | 142..299 | CDD:280373 | |
RGS_SNX25 | 422..531 | CDD:188675 | |||
PX_SNX25 | 645..788 | CDD:132788 | 16/78 (21%) | ||
Nexin_C | 882..987 | CDD:285792 | |||
snx22 | NP_001038839.2 | PX_SNX22 | 11..121 | CDD:132790 | 17/86 (20%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2101 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |