DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snz and snx16

DIOPT Version :9

Sequence 1:NP_001284993.1 Gene:snz / 31704 FlyBaseID:FBgn0029976 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_991228.1 Gene:snx16 / 402964 ZFINID:ZDB-GENE-040426-1832 Length:294 Species:Danio rerio


Alignment Length:151 Identity:34/151 - (22%)
Similarity:64/151 - (42%) Gaps:26/151 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 RKLIETFLLGDAEPDIF--YDIQRNVLRTLEEKYYPPFVLSDQYRQL-KEALDSNEIADPTLLMC 549
            |:..:...|.|...|:|  :.:.....|..::.|...|:   :.||| .:....|.:|...:..|
Zfish   101 RRYTDFSRLNDKLKDMFPGFRLSLPPKRWFKDNYETEFL---EERQLGLQTFLQNLVAHKDIASC 162

  Fly   550 HTIGDVQEPLA-DEQPGAADGLNGGAGGAIDVAAHTSYARRKLEQIQERIDKKNQALDALKYSVK 613
            ..   |:|.|. |:.||..|.|. .:....:.....:|      ::|:.:.:|.:.:::||.   
Zfish   163 VA---VREFLCLDDPPGPFDSLE-ESRAFCETLEECNY------RLQKELLEKQREINSLKE--- 214

  Fly   614 PESKVLTILEKEMEWLKSEKR 634
                  |:.|||::..|.|:|
Zfish   215 ------TLEEKELQIQKLEER 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snzNP_001284993.1 PXA 142..299 CDD:280373
RGS_SNX25 422..531 CDD:188675 8/44 (18%)
PX_SNX25 645..788 CDD:132788
Nexin_C 882..987 CDD:285792
snx16NP_991228.1 PX_SNX16 63..172 CDD:132809 17/76 (22%)
DUF4200 <181..230 CDD:290574 13/65 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.