DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snz and snx27b

DIOPT Version :9

Sequence 1:NP_001284993.1 Gene:snz / 31704 FlyBaseID:FBgn0029976 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_956834.1 Gene:snx27b / 393512 ZFINID:ZDB-GENE-040426-1529 Length:569 Species:Danio rerio


Alignment Length:235 Identity:55/235 - (23%)
Similarity:98/235 - (41%) Gaps:45/235 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 LMHATTMQNLQR-----AKGLDPDHEDHSLSKSELTAAVR-LKRYVRQLTMAK--GE---CEKNL 402
            ::|    |||:|     |....|.....|||:.:|.|..| |:.|:.::...:  ||   .::.|
Zfish   207 ILH----QNLKREFANFAFPKLPGKWPFSLSEQQLDARRRGLEEYLEKVCSVRVIGESDIMQEFL 267

  Fly   403 AKFGWNGNYSSDIDLTL---------VEILNTAVGRRYFTLFLEPLKASALIGFYLAV-EEIKH- 456
            ::...|.|..||::|.:         |.:.......:.:...:..:...::...|.|: |.|.| 
Zfish   268 SESDENYNGVSDVELRIAMPDKTTVTVRVRKNCTTDQVYQAVVTKIGMDSITASYFALFEVINHT 332

  Fly   457 -AHKSASHQLGTEIF---YTYIRVPKSEIQIDKHERKLIETFLLGDAEPDIFY-------DIQRN 510
             |.|.|.::...:::   || ..||.:.:.:.|......|..||.|.|..|.|       |:::.
Zfish   333 FARKLAPNEFPHKLYVQNYT-SAVPGTCLTLRKWLFTTEEEILLNDNELAINYCFHQALDDVKKG 396

  Fly   511 VLRTLEEKYYPPFVLSDQYRQ------LKEALDSNEIADP 544
            .:: :.||.|....|::|.:.      |:.....|||..|
Zfish   397 FIK-VGEKSYQLQKLTEQRKMTMYLSILRTCEGYNEITFP 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snzNP_001284993.1 PXA 142..299 CDD:280373
RGS_SNX25 422..531 CDD:188675 26/121 (21%)
PX_SNX25 645..788 CDD:132788
Nexin_C 882..987 CDD:285792
snx27bNP_956834.1 PDZ_signaling 46..138 CDD:238492
PX_SNX27 165..270 CDD:132796 18/66 (27%)
SNX27_RA 279..365 CDD:176372 15/86 (17%)
FERM-like_C_SNX27 430..531 CDD:270146 4/6 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1370
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.