DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snz and Snx22

DIOPT Version :9

Sequence 1:NP_001284993.1 Gene:snz / 31704 FlyBaseID:FBgn0029976 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001020783.1 Gene:Snx22 / 382083 MGIID:2685966 Length:192 Species:Mus musculus


Alignment Length:164 Identity:37/164 - (22%)
Similarity:65/164 - (39%) Gaps:33/164 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 VEILNTAVGRRYFTLFLEPLKASALIGFYLAVEEIKHAHKSASHQLGTEIFYTYIRVPKSEIQID 484
            ||:|.:  |||:..    |.:.|.   |:...:.||..:|...        :...|:|....:..
Mouse    29 VEVLYS--GRRHTV----PRRYSE---FHALHKRIKKRYKVPD--------FPSKRLPNWRTRGL 76

  Fly   485 KHERKLIETFLLGDAEPDIFY---DIQRNVLRTLEEKYYPPFVLSDQYRQLKEALDSNEIAD--- 543
            :..|:.:||::.|     |.|   |:.:.:|..|..:::|....:..:..|.|.|.|:..:.   
Mouse    77 EQRRQGLETYIQG-----ILYLNQDVPKELLEFLRLRHFPTDSKTSSWSTLGEFLPSDTSSQLHH 136

  Fly   544 -PTLLMC---HTIGDVQEPLAD-EQPGAADGLNG 572
             |.:..|   :......|||.: ...|...||.|
Mouse   137 RPVIGFCMDPYVCTPSPEPLPEVVVDGVLQGLYG 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snzNP_001284993.1 PXA 142..299 CDD:280373
RGS_SNX25 422..531 CDD:188675 22/111 (20%)
PX_SNX25 645..788 CDD:132788
Nexin_C 882..987 CDD:285792
Snx22NP_001020783.1 PX_SNX22 2..115 CDD:132790 24/107 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.