DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snz and Snx16

DIOPT Version :9

Sequence 1:NP_001284993.1 Gene:snz / 31704 FlyBaseID:FBgn0029976 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster


Alignment Length:392 Identity:79/392 - (20%)
Similarity:130/392 - (33%) Gaps:120/392 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   528 QYRQLK-------EALDSNEIA---DPTLLMCHTIGDVQEPLADEQPGAADGLNGGAGGAIDVAA 582
            |:|:.|       .:.|..:|.   :.:||...:.|||...||.         |.|        |
  Fly    63 QFREQKLLGRKCHSSPDLRQIGKYQNNSLLRSKSEGDVSLILAS---------NSG--------A 110

  Fly   583 HTSYARRKLEQIQERID------------KKNQALDALK----------------YSVKPESKVL 619
            ..:.|..|.|...:||.            .|::.|...:                :||..||:  
  Fly   111 PLTVANAKSEVCLQRISSHSYEQSPRTPINKSEMLGGARSHRDLTQSSYGNQAGGHSVDLESR-- 173

  Fly   620 TILEKEMEWLKSEKRQTEAHLRRTDAWTEHLGK-----WKATIQS---VEVSDEKESLQFMILVH 676
                     .::.:|.:|..|..:.:.:.|.|.     .:.|:.|   |...|....|:..|:.:
  Fly   174 ---------SRTPRRMSECSLGYSQSSSRHTGSNSMFASQMTLSSGSVVPPVDPNAVLRVPIIGY 229

  Fly   677 VDEDINAPVQPTSSKNGDSGHANLRKRPSGISSGWVVMRSLNQVHELQRKLRHVSSNLKAIDLP- 740
              |.:....:.|:.|        ||......:..|:|||.......|..||:....|| .:.|| 
  Fly   230 --EVMEERARFTAYK--------LRVENPETNDYWLVMRRYTDFVRLNSKLKQAFPNL-TLMLPR 283

  Fly   741 -----TNFKFFFLKTDRHGQEKAKSQIQKFLNFILEDDHLNGSEAIYTFLSPSSDHLKQSLPSPK 800
                 .||...||.....|       :|.|:|.::..:.|...:.:..|......      ||..
  Fly   284 KKLFGDNFNAVFLDNRVQG-------LQIFVNSVMAKEELRKCKLVREFFCLDEP------PSYS 335

  Fly   801 KSKFSLSTLFRSDAGKAHEASKATDPFWGLQ-RDDEDISTYLDGESGGEAKMLAADLDSKDSIAE 864
            :|......:|        ||.:.|.....|| |:..|:...|.       :.|..:::.|:.:.|
  Fly   336 ESMEECRAIF--------EAQEETIEHLKLQIRNKNDLILSLQ-------QKLREEMNEKEQLRE 385

  Fly   865 PM 866
            .|
  Fly   386 AM 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snzNP_001284993.1 PXA 142..299 CDD:280373
RGS_SNX25 422..531 CDD:188675 1/2 (50%)
PX_SNX25 645..788 CDD:132788 34/156 (22%)
Nexin_C 882..987 CDD:285792
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 28/127 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.