DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snz and Snx24

DIOPT Version :9

Sequence 1:NP_001284993.1 Gene:snz / 31704 FlyBaseID:FBgn0029976 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001008365.1 Gene:Snx24 / 361328 RGDID:1306864 Length:169 Species:Rattus norvegicus


Alignment Length:153 Identity:33/153 - (21%)
Similarity:57/153 - (37%) Gaps:42/153 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   699 NLRKRPSGISSGWVVM--------------RSLNQVHELQRKLRHVSSNLKAIDLPTNFKFFFLK 749
            :.|...|.:..|:.|.              :..::.|.|.:||:..   :|..::|:       |
  Rat     7 SFRHEDSDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKC---IKTPEIPS-------K 61

  Fly   750 TDRHGQEKAKSQIQKFLNFILEDDHLNGSEAIYTFLSPSSDHLK-QSLPSPKKSKFSLSTLFRSD 813
            ..|:...|...|.::.|...|:...|...|....||    |.|. :.|||..|::...|    .|
  Rat    62 HVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFL----DFLNVRHLPSLPKAESCGS----FD 118

  Fly   814 AGKAHEASKAT---------DPF 827
            ..::.|:||.:         ||:
  Rat   119 ETESEESSKLSHQPVLLFLGDPY 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snzNP_001284993.1 PXA 142..299 CDD:280373
RGS_SNX25 422..531 CDD:188675
PX_SNX25 645..788 CDD:132788 20/102 (20%)
Nexin_C 882..987 CDD:285792
Snx24NP_001008365.1 PX_SNX22 1..111 CDD:132790 25/117 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.