DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snz and CG8726

DIOPT Version :9

Sequence 1:NP_001284993.1 Gene:snz / 31704 FlyBaseID:FBgn0029976 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_610341.2 Gene:CG8726 / 35758 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster


Alignment Length:615 Identity:119/615 - (19%)
Similarity:188/615 - (30%) Gaps:250/615 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   695 SGHAN--LRK-RPSGISSGWVVMRSLNQVHELQRKLRHVSSNLKAIDLPTNFKFFFLKTDRHGQE 756
            :||..  ||. |.:...:.|.|:|..|....|.:.||     :..|:||...|..|.........
  Fly    31 AGHTEYLLRVWRGASNKNYWTVLRRYNDFDRLDKSLR-----VSGIELPLPRKRIFGNMRPEFIA 90

  Fly   757 KAKSQIQKFLNFILEDDHLNGSEAIYTFLSPSS------DH------------------------ 791
            :.|..:|:::|.:|.:..|..|.....|:.|.|      ||                        
  Fly    91 ERKQALQEYINAVLMNPILASSLPAKRFVDPESYSQSFHDHAVQNAMLCLRNDTTWSLGGSMGAI 155

  Fly   792 --------LKQSLPSPKKSKFSLSTLFRSDA--------------GKAHEASKAT-DPFWGLQRD 833
                    .|.:...|:||  |...|.:|.:              |..|.....| ||      .
  Fly   156 GWRLRKHYFKVTTKPPEKS--SNKQLVKSGSQTHQSKHFAAGSSNGSGHSIDAGTLDP------G 212

  Fly   834 DEDISTYL---------DGESGG-------------EAKMLAADLDS--------------KDSI 862
            .|.::.:|         :.|.||             |..:|||..::              ||.:
  Fly   213 SEVVAEWLEYGPDKFIDEKEIGGIMKSLMGLQHPHIEPVLLAAHTENGCLVIRKFHKHGTLKDVL 277

  Fly   863 ---AEPMYALMGEIFDMGGVFKWLRKSLISFVQI-TYGRTINRQIRESVAYLFEES--------- 914
               |.|....:.:..:..|      ::.:|..|: |||    :||.|::.:|..:.         
  Fly   278 CMAANPKNTFLSKYGNPKG------RTALSMKQVATYG----KQILEALIFLHSKGYAYGHLHSG 332

  Fly   915 -----------------------------MLHNYFSAI--LKSFWPGGVL---ASAYPTRSEDMR 945
                                         |.|:...||  :..:..|.||   |..||.:...:|
  Fly   333 NIVIVDDCVKLLDIENFLLGVPAFYRPFFMQHSKIHAIETIDVYCFGHVLFEMAMGYPLQESVVR 397

  Fly   946 EMT--TTAAKALLTDHIPEVLC--------NLVG------------AQAA--------------- 973
            ::|  ..|.|.||...:.:..|        .|:|            |.||               
  Fly   398 QITECPEALKCLLESILSKEACKAGLPTLEQLLGHRFFLQYASTESAGAAANAEKPYFKLSLNAK 462

  Fly   974 ---KRGVLKVFDAL---QNPAYNKQLFYELLEILMIEFFPEIR-----------------QLRVS 1015
               |:..:|..:.|   |....|::....:.|::..|  .|.|                 |..:.
  Fly   463 ELLKQAAIKSENRLRDEQKSVKNQKRIVRVQELMSSE--EEKRKSKQKAKLEHKQSKLKQQSSIQ 525

  Fly  1016 NSNGTKLNTATAGAAAASAAAALVA-----------------ATASASLPSLNHSGGGHSA---- 1059
            .:|| :|:...|.|||||::..:|.                 .|..|.:.|...:.|.|..    
  Fly   526 TNNG-RLSLVAATAAAASSSTTVVGELCGTDSFNRSDSTPEEPTTLAGIKSPPLTPGPHLGSIYQ 589

  Fly  1060 ----STGGHQNHQGSSSASGSSAGASGATG 1085
                ||.|....:.||:.:..|..|.|..|
  Fly   590 QELPSTTGAPVERQSSTPNMLSEDAEGGDG 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snzNP_001284993.1 PXA 142..299 CDD:280373
RGS_SNX25 422..531 CDD:188675
PX_SNX25 645..788 CDD:132788 24/95 (25%)
Nexin_C 882..987 CDD:285792 35/191 (18%)
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 27/105 (26%)
PKc 237..432 CDD:270622 36/204 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.