DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snz and CG5439

DIOPT Version :9

Sequence 1:NP_001284993.1 Gene:snz / 31704 FlyBaseID:FBgn0029976 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster


Alignment Length:608 Identity:107/608 - (17%)
Similarity:207/608 - (34%) Gaps:206/608 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 QNIETRLAAAAMSKRSYEYAASFEDFLKIINNSGNLEELSLIRKSIVNDLMHATTMQNLQRAKGL 364
            :::.::||.:...:|..:.....::....|:...:.:||:..|...|.:|  ..:::.|.     
  Fly    16 RSMRSQLAGSTFGQRREDIFRRLQESAHKISQKFSGKELATERDESVQEL--CESLEELM----- 73

  Fly   365 DPDHEDHSLSKSELTAAVRLKRYVRQL-TMAKGECEKNLAKFGWNGNYSSDIDLTLVEILNTAV- 427
                 .:.|.:|..|::.....:::.: .|..|..          |..|::.|.|..|...|.: 
  Fly    74 -----SYGLRQSAGTSSFSAASFIQNMQEMVSGNA----------GGGSNNNDATFWEFCQTHLT 123

  Fly   428 -------------------GRRYFTLFLEPLKASALIGFYLAVEEIKHAHKSASHQLGTEIFYTY 473
                               ||.:....|...:..:.:..:|:.||..|.            ||| 
  Fly   124 PHERQRYMDLKQIWTNVGRGRAFIRATLNEKRLHSHVLTWLSDEEQLHR------------FYT- 175

  Fly   474 IRVPKSEIQIDKHERKLIETFLLGDAEPDIFYDIQRNVLRTLEEKYYPPFVLSDQYRQLKEALDS 538
               |.|.:..|:..:||.|   :.|:..|:.:.:..:.......:...|.|      .:||    
  Fly   176 ---PWSLLLNDEAAKKLPE---IVDSLSDVLFALNVDTTELNAPRRSTPSV------AVKE---- 224

  Fly   539 NEIADPTLLMCH---TIGDVQEP-LADEQP----GAADGLNGGAGGAIDVAAHTSYARRKLE--Q 593
                :|.:....   .:|..:.| :|.|:|    .:.:.|.|              |.:.:|  :
  Fly   225 ----EPIIFTTSPVPVVGRQKRPGIAVERPIECVSSTEDLLG--------------ALKPIESVE 271

  Fly   594 IQERIDKKN--QALDALKYSVKPESKV----LTILEKEMEWLKSEKRQTEAHL-------RRTDA 645
            :|:.:.|::  |.|      .:|:.:|    ...:|.|:|:||:......||:       .|:|.
  Fly   272 VQQILSKESIEQEL------AQPQEEVNLGPFDPIEPELEFLKTPLPDIGAHVGESELYEDRSDT 330

  Fly   646 ---WT-------------------EHLGKWKATIQSVEVSDEKESLQFMILVH--VDEDINAPVQ 686
               |:                   ||:.:.......:|....:.|||..:|:.  ..:.....:.
  Fly   331 SSQWSKSSSSANCLANSQQQAALEEHVNQLNERCALLETRVAELSLQNRLLIRRLTKQFEETGID 395

  Fly   687 PTSS---------------KNGDSG-------HANLRKRPSGISSGWVVMRSLNQVHELQRKLRH 729
            |:||               |...||       |..:|:|    ...|...|..::.::|.:.|..
  Fly   396 PSSSLCSNFLITIPHVKLAKTQRSGSHYTYEVHITMRQR----LEHWTFFRRYSEFYKLHKSLLK 456

  Fly   730 VSSNLKAIDLPT-----NFKFFFLKTDRHGQEKAKSQIQKFLNFILEDDHLNGSEAIYTFLSPSS 789
            ....:.|::.|.     |....|:       |:.:.|:|.:|        ||             
  Fly   457 THPVVSAVEFPPKKHFGNMNLVFV-------EERRQQLQIYL--------LN------------- 493

  Fly   790 DHLKQSLPSPK--KSKFSLSTLF 810
              |.::||..:  |||..|..:|
  Fly   494 --LVETLPQVEACKSKAELQKVF 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snzNP_001284993.1 PXA 142..299 CDD:280373
RGS_SNX25 422..531 CDD:188675 21/128 (16%)
PX_SNX25 645..788 CDD:132788 31/193 (16%)
Nexin_C 882..987 CDD:285792
CG5439NP_609607.1 RUN 64..206 CDD:280855 31/182 (17%)
PX_RUN 404..520 CDD:132810 28/145 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.