DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snz and Snx20

DIOPT Version :9

Sequence 1:NP_001284993.1 Gene:snz / 31704 FlyBaseID:FBgn0029976 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001020170.1 Gene:Snx20 / 307742 RGDID:1307787 Length:313 Species:Rattus norvegicus


Alignment Length:287 Identity:49/287 - (17%)
Similarity:88/287 - (30%) Gaps:113/287 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 LAAAAMSKRSYEYAASFEDFLKIINNSGNLEELSLIRKSIVNDLMHATTMQNLQRA--KGLDPDH 368
            :|:|.:.:|.   .:.|..:..::..:|:.:.    .|::|.  ...:..:.||||  |...|:.
  Rat    77 IASARIEERK---VSKFVMYQVVVIQTGSFDS----DKAVVE--RRYSDFERLQRALLKRFGPEL 132

  Fly   369 EDHSLSKSELTA----------AVRLKRYVRQLTMAKGE---------------CEKNLAKFGW- 407
            ||.:..:..||.          .:.|:.|:|.|...:..               ||    .||. 
  Rat   133 EDVTFPRKRLTGNLSAETICERRLELREYLRLLYAVRAVRRSREFADFLTRPELCE----AFGCL 193

  Fly   408 -NGNYSSDIDLTLVEILNTAVGR-----RYFTLFLEPLKASALIGFYLAVEEIKHAHKSASHQLG 466
             .|.|:..:||         :||     ...|.........||....:.:.:::           
  Rat   194 RAGQYARALDL---------LGRVVPLQEKLTAHCPSAPVPALCAMLVCLRDLE----------- 238

  Fly   467 TEIFYTYIRVPKSEIQIDKHERKLIETFLLGDAEPDIFYDIQRNVLRTL----EEKYYPP----- 522
                                  :..|.|.:|:           ..||.|    ..:||.|     
  Rat   239 ----------------------RPAEAFAVGE-----------RALRRLGARESHRYYAPLLDAM 270

  Fly   523 ----FVLSDQYRQLKEALDSNEIADPT 545
                :.|......|:..||.:::..||
  Rat   271 VRLAYALGKDLASLQGRLDESQLRRPT 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snzNP_001284993.1 PXA 142..299 CDD:280373
RGS_SNX25 422..531 CDD:188675 15/126 (12%)
PX_SNX25 645..788 CDD:132788
Nexin_C 882..987 CDD:285792
Snx20NP_001020170.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..61
PX_domain 73..186 CDD:295365 21/117 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.