DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snz and nish-1

DIOPT Version :9

Sequence 1:NP_001284993.1 Gene:snz / 31704 FlyBaseID:FBgn0029976 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_502016.2 Gene:nish-1 / 177981 WormBaseID:WBGene00008750 Length:497 Species:Caenorhabditis elegans


Alignment Length:428 Identity:87/428 - (20%)
Similarity:144/428 - (33%) Gaps:139/428 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KNPSNLPLIFGKTVDLQLQQIIEYVLRDFML-------PWLGYVVTKPK----------LINDVV 176
            ||..:||||..|..|.. |..|..::.|..|       .||....|.||          .|.:.:
 Worm   110 KNVHSLPLITAKFFDFH-QYEIHSIVDDLSLRLGNLGDGWLESSQTSPKYFEFTPIELHAITERL 173

  Fly   177 R------------EDLWNAIQKIHE-RALRM---------------------------------- 194
            |            .|:.|.|..:|. |||::                                  
 Worm   174 RLPEPTAPDVNMVADIGNTIDFLHRVRALKIRGQKGYVGTSNIVWNSLDMSLYFCKGLKALWIAD 238

  Fly   195 -DAAKIIAV----DMVNRVTVH--LEKIR--IAEARAAETNTPPVFSTNSYLADEEKEMEFLRKL 250
             |..:|..:    :.:.|:.||  ::||:  :.:....||.. .|...:::...||.::.|....
 Worm   239 SDVCRINGIKSIRETLRRLVVHYSMKKIKDLLFDEEDLETGM-LVEEMDTWKCLEEVDLSFNEIK 302

  Fly   251 C--EIMVILLLPRGYSLPPLKVL------LSEILSYKIFFPMIKMLTAPDYINQKVVQNIETRLA 307
            |  |.|.:        ||.::||      ::||.|...|   :..||..|..|     |..|::.
 Worm   303 CFDESMKL--------LPEVRVLNVSYNSITEIGSNLAF---LSSLTELDLSN-----NTLTKID 351

  Fly   308 AAAMSKRSYEYAASFEDFLKIINNSGNLEELSLIRKSIVNDLMHA--TTMQNLQRAKGLD--PDH 368
            .         :.....:..|:|.:...:|:||.:.|....:.:.|  ..:|||...:|:.  |..
 Worm   352 G---------WNEKLGNIKKLILSENAIEDLSGLGKLYSLEYLDAKGNNIQNLDAVQGIGKLPCL 407

  Fly   369 EDHSLSKSELTAAVRLKRYVRQLTMAKGECEKNLAKFGWNGNYSSDIDLTLVEILNTAVGRRYFT 433
            |...|..:.:...|..:..|.:|.                |..||::.|.         |||...
 Worm   408 EILLLRDNPIRKLVEYRTKVLELF----------------GERSSELKLD---------GRRPEA 447

  Fly   434 LFLEPLKASALIGFYLAVEEIKHAHKSASHQLGTEIFY 471
            ..|:.::..  :....|.||.:...|....::...|.|
 Worm   448 RELDTVRVR--MALRKAKEEKEEREKKRRERIEERIRY 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snzNP_001284993.1 PXA 142..299 CDD:280373 47/237 (20%)
RGS_SNX25 422..531 CDD:188675 10/50 (20%)
PX_SNX25 645..788 CDD:132788
Nexin_C 882..987 CDD:285792
nish-1NP_502016.2 PX_domain 18..137 CDD:383026 10/27 (37%)
LRR <289..423 CDD:227223 35/158 (22%)
leucine-rich repeat 291..313 CDD:275380 7/29 (24%)
leucine-rich repeat 314..336 CDD:275380 6/24 (25%)
leucine-rich repeat 337..359 CDD:275380 6/35 (17%)
leucine-rich repeat 360..381 CDD:275380 6/20 (30%)
leucine-rich repeat 382..406 CDD:275380 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.