DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snz and SNX20

DIOPT Version :9

Sequence 1:NP_001284993.1 Gene:snz / 31704 FlyBaseID:FBgn0029976 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_878274.1 Gene:SNX20 / 124460 HGNCID:30390 Length:316 Species:Homo sapiens


Alignment Length:333 Identity:69/333 - (20%)
Similarity:118/333 - (35%) Gaps:98/333 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 TMQNLQRAKGLDPD--------HED-HS-LSKSELTAAVRLKRY-------------VRQLTMAK 395
            |.:..|.|....||        |.| || ||.:.......|::|             :.::..|:
Human    20 TARTQQEAPATGPDLPHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASAR 84

  Fly   396 GECEKNLAKFG-------WNGNYSSDIDLTLVEILNTAVGRRYFTLFLEPLKASALIGFYLAVEE 453
            .| |:.::||.       ..|::.:          |.||..|.::.|.: |:.:.|..|...:|:
Human    85 IE-ERKVSKFVVYQIIVIQTGSFDN----------NKAVLERRYSDFAK-LQKALLKTFREEIED 137

  Fly   454 IKHAHKSASHQLGTEIFYTYIRVPKS------EIQIDKHERKLIETFLLGDAEPDIFYDIQRNVL 512
            ::...|..:.....|:.....|..:.      .|:..:..|:.:: ||   ..|::     |...
Human   138 VEFPRKHLTGNFAEEMICERRRALQEYLGLLYAIRCVRRSREFLD-FL---TRPEL-----REAF 193

  Fly   513 RTLEEKYYP-PFVLSDQYRQLKEALDSN--EIADPTL---LMCHTIGDVQEPLADEQPGAADGLN 571
            ..|....|| ...|..:...|:|.|.::  ..|.|.|   |:||.  |:..|        |:...
Human   194 GCLRAGQYPRALELLLRVLPLQEKLTAHCPAAAVPALCAVLLCHR--DLDRP--------AEAFA 248

  Fly   572 GGAGGAIDVAAHTSYARRKLEQIQERIDKKNQA--LDALKYSVKPESKVLTILEKEMEWLKSEKR 634
            .|              .|.|:::|.|...:..|  |||:........|....|::.:|       
Human   249 AG--------------ERALQRLQAREGHRYYAPLLDAMVRLAYALGKDFVTLQERLE------- 292

  Fly   635 QTEAHLRR 642
              |:.|||
Human   293 --ESQLRR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snzNP_001284993.1 PXA 142..299 CDD:280373
RGS_SNX25 422..531 CDD:188675 22/115 (19%)
PX_SNX25 645..788 CDD:132788
Nexin_C 882..987 CDD:285792
SNX20NP_878274.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..54 10/30 (33%)
PX_SNX20 76..189 CDD:132833 23/128 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.