DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spidey and HSD17B12

DIOPT Version :9

Sequence 1:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_057226.1 Gene:HSD17B12 / 51144 HGNCID:18646 Length:312 Species:Homo sapiens


Alignment Length:303 Identity:139/303 - (45%)
Similarity:199/303 - (65%) Gaps:20/303 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VGFQVFRKVLPWIYANV--VGPKVFGSSVDLSKMGEWAVVTGSTDGIGKAYAKELARRGLKLVLI 82
            :.:.:|..:..|...|.  |||          .:|||||||||||||||:||:|||:.|:|:|||
Human    26 ISYSLFTALRVWGVGNEAGVGP----------GLGEWAVVTGSTDGIGKSYAEELAKHGMKVVLI 80

  Fly    83 SRSLEKLNVVAKEIGDKYGVEVRVIDVDFTGGDEIYDKIREKTTGLNVGVLVNNVGISYGHPEYF 147
            |||.:||:.|:.||.:|:.||.|.|.||| ..::|||||:....||.:|:||||||:||.:||||
Human    81 SRSKDKLDQVSSEIKEKFKVETRTIAVDF-ASEDIYDKIKTGLAGLEIGILVNNVGMSYEYPEYF 144

  Fly   148 LDCYKADPPFLRNIVAANIHSVTHMTALFLPGMISQRRGVIINVSSTAGVIPNPLLSVYSSTKAF 212
            ||....| ..::.::..||.||..||.|.||||:.:.:|.|:|:||.:|::|.|||::||:||.|
Human   145 LDVPDLD-NVIKKMININILSVCKMTQLVLPGMVERSKGAILNISSGSGMLPVPLLTIYSATKTF 208

  Fly   213 VNKFSDDLQTEYKEHGILIQSVQPGFVATNMSKIRKASVFAPSPETYVRSALSTLGIATQTAGYL 277
            |:.||..|..||:..|:.:|||.|.||||.::||||.::..|||||:|:||:.|:|:.::|.|||
Human   209 VDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNGYL 273

  Fly   278 PHALL-QLVIHFTEAVFGEQFARNIVMKNILGTRKRALRRLAK 319
            .|||: .::.:....::     ..|||.....||...|::..|
Human   274 IHALMGSIISNLPSWIY-----LKIVMNMNKSTRAHYLKKTKK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spideyNP_572420.1 PLN02780 8..321 CDD:166421 139/303 (46%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 126/236 (53%)
HSD17B12NP_057226.1 NADB_Rossmann <3..>83 CDD:304358 32/66 (48%)
DltE 50..300 CDD:223377 129/256 (50%)
17beta-HSD1_like_SDR_c 50..289 CDD:187614 126/240 (53%)
Di-lysine motif 308..312 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 205 1.000 Domainoid score I2934
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H95094
Inparanoid 1 1.050 253 1.000 Inparanoid score I3211
Isobase 1 0.950 - 0.803099 Normalized mean entropy S1433
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 1 1.000 - - oto91626
orthoMCL 1 0.900 - - OOG6_100431
Panther 1 1.100 - - LDO PTHR43899
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R721
SonicParanoid 1 1.000 - - X484
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.820

Return to query results.
Submit another query.