DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spidey and hsdl1

DIOPT Version :9

Sequence 1:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001008607.1 Gene:hsdl1 / 494064 ZFINID:ZDB-GENE-041212-31 Length:319 Species:Danio rerio


Alignment Length:268 Identity:94/268 - (35%)
Similarity:150/268 - (55%) Gaps:19/268 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DLSKM-GEWAVVTGSTDGIGKAYAKELARRGLKLVLISRSLEKLNVVAKEIGDKYGVEVRVIDVD 110
            |||:. |:||::.|:::.|.||||:||||.|:.::|||:.|..::..|:.|.:.||||...|:.|
Zfish    61 DLSQQYGQWAIICGASEAIAKAYAEELARHGICVILISKDLSSVSDTARLISNNYGVEAICIEAD 125

  Fly   111 FTGGDEIYDKIREKTTGLNVGVLVNNVGISYGHPEYFLDCYKADPPFLRNIVAANIHSVTHMTAL 175
            |..|......|::..:..::|.:||:...:....:.||:..::   .|...:..||.:.|.:|.|
Zfish   126 FNQGPSACKPIKDAISSKDIGFIVNSFDGTLEISQNFLELSES---VLWGTIDRNIAATTLVTRL 187

  Fly   176 FLPGMISQRRGVIINVSSTAGVIPNPLLSVYSSTKAFVNKFSDDLQTEYKEHGILIQSVQPGFVA 240
            .||.|:.:.||.::|:||.....|.|..:.:|::.||::.||..||.||.:.|:.:||:.|..||
Zfish   188 ALPAMMERGRGAVVNISSGHCFHPIPRKAAFSASTAFLDNFSRSLQYEYGDQGVFVQSLLPFRVA 252

  Fly   241 TNM--SKIRKASVFAPSPETYVRSALSTLGIATQTAGYLPHAL-LQLVIHFTEAVFGEQFARNIV 302
            :..  .....||...|||:.|...|||||||:.:|.||.||:: |.||....|.|:         
Zfish   253 SQRPEGSAPPASWLVPSPQVYASHALSTLGISHRTTGYWPHSMQLGLVKMMPEWVW--------- 308

  Fly   303 MKNILGTR 310
               :||:|
Zfish   309 ---MLGSR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spideyNP_572420.1 PLN02780 8..321 CDD:166421 94/268 (35%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 86/238 (36%)
hsdl1NP_001008607.1 Required for mitochondria translocation. /evidence=ECO:0000250 2..82 8/20 (40%)
17beta-HSD1_like_SDR_c 67..307 CDD:187614 87/242 (36%)
adh_short 68..248 CDD:278532 61/182 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.