DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spidey and sro

DIOPT Version :9

Sequence 1:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster


Alignment Length:272 Identity:65/272 - (23%)
Similarity:127/272 - (46%) Gaps:46/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VVTGSTDGIGKAYAKELARRGLKLVLIS-----RSLEKLNVVAKEIGDKYGV-EVRVIDVDFTGG 114
            ::||...|:|.:.| ......|.:.:||     :| |...::......|.|: .:..:::|....
  Fly    30 LITGCDSGLGHSMA-VYCHESLHMTVISCCHNIKS-EGAKLLQGLASAKDGLSRMHTLELDLLEP 92

  Fly   115 DEI---YDKIRE---KTTGLNVGVLVNNVGI-SYGHPEYFL-DCYKADPPFLRNIVAANIHSVTH 171
            |.|   :.::|:   |.....:..|:||.|: .:|..|:.| :..:|.       :..|:.....
  Fly    93 DSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQIEAQ-------INCNLLGTMR 150

  Fly   172 MTALFLPGMISQRRGVIINVSSTAGVIPNPLLSVYSSTKAFVNKFSDDLQTEYKEHGILIQSVQP 236
            :|...|| ::.|::|.||||:|..|:...|.|..|:::||.:..::|.|:.|.:::|:.:.:..|
  Fly   151 LTHELLP-LLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVVNFIP 214

  Fly   237 G-FVA-TNMS--------KIRKASVFAPSP----ETYVRSALSTLGIATQTAGYLPHALLQ---L 284
            | ||. :|::        |:|:|  |:...    :||..:....|.:   .:|:.|...|:   |
  Fly   215 GSFVLDSNIAARQQQHAQKMREA--FSAEQHALYDTYFEAFNGYLKV---LSGFKPPNRLRNESL 274

  Fly   285 VIHFTEAVFGEQ 296
            :..|.:|:...|
  Fly   275 LAKFKDALTSSQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spideyNP_572420.1 PLN02780 8..321 CDD:166421 65/272 (24%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 62/262 (24%)
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 65/272 (24%)
adh_short 28..229 CDD:278532 51/208 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447494
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.