DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spidey and CG17121

DIOPT Version :9

Sequence 1:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster


Alignment Length:324 Identity:84/324 - (25%)
Similarity:151/324 - (46%) Gaps:57/324 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NSQVLSLLGGLAIGIVGFQVFRK-VLPWIYANVVGPKVFGSSVDLSKMGEWAVVTGSTDGIGKAY 68
            |.:|:..|  |.:.:|...||.| :|.:::|  :|.|    ..|:|  |:.|:|||...|:|:..
  Fly    54 NLKVIVFL--LLLPLVLLAVFLKHLLDYLFA--LGLK----EKDVS--GKVALVTGGGSGLGREI 108

  Fly    69 AKELARRGLKLVLIS-------RSLEKLNVVAKEIGDKYGVEV---RVIDVDFTGGDEIYDKIRE 123
            ..||||||.||.::.       .::|.|:.:.:.:...|..:|   |.:.:       :..|: |
  Fly   109 CLELARRGCKLAVVDVNSKGCYETVELLSKIPRCVAKAYKNDVSSPRELQL-------MAAKV-E 165

  Fly   124 KTTGLNVGVLVNNVGISYGHPEYFLDCYKADPPFLRNIVAANIHSVTHMTALFLPGMISQRRGVI 188
            |..| .|.:||||..:.   |.......|:|.  :..|:..|:.|....|..|||.||:::.|.:
  Fly   166 KELG-PVDILVNNASLM---PMTSTPSLKSDE--IDTILQLNLGSYIMTTKEFLPKMINRKSGHL 224

  Fly   189 INVSSTAGVIPNPLLSVYSSTKAFVNKFSDDLQTEYKEHGILIQSVQPGFVATNMSK--IRKASV 251
            :.|::.||::|.|...:|::||..:..|.:.|:.|       ::.....:|.|.::.  :.:.|.
  Fly   225 VAVNALAGLVPLPGAGIYTATKYGIEGFMESLRAE-------LRLSDCDYVRTTVANAYLMRTSG 282

  Fly   252 FAPSPETYVRSALSTLGIATQTAG----YLPHALLQLVIHFTEAVFGEQ-FARNIVMKNILGTR 310
            ..|        .||..|||....|    |:...:::.|:.....|:..: ||.::.:..:|.|:
  Fly   283 DLP--------LLSDAGIAKSYPGLPTPYVAEKIVKGVLLNERMVYVPKIFALSVWLLRLLPTK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spideyNP_572420.1 PLN02780 8..321 CDD:166421 83/321 (26%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 65/251 (26%)
CG17121NP_651114.1 DltE 91..349 CDD:223377 71/279 (25%)
NADB_Rossmann 94..338 CDD:304358 68/272 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447516
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.