DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spidey and hsd20b2

DIOPT Version :9

Sequence 1:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001373557.1 Gene:hsd20b2 / 368367 ZFINID:ZDB-GENE-030804-21 Length:329 Species:Danio rerio


Alignment Length:302 Identity:134/302 - (44%)
Similarity:176/302 - (58%) Gaps:22/302 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GIVGFQVFRKVLPWIYANVVGPKVFGSS----VDLSKMGEWAVVTGSTDGIGKAYAKELARRGLK 78
            ||....|...:|.|.:....|.||:..|    .||...|.||||||:|.|||:|||:|||:|||.
Zfish    16 GIGCVTVVYYMLRWSWQCWHGFKVYVISEIWRTDLRTYGRWAVVTGATSGIGRAYAEELAKRGLN 80

  Fly    79 LVLISRSLEKLNVVAKEIGDKYGVEVRVIDVDFTGGDEIYDKIREKTTGLNVGVLVNNVGISY-G 142
            :||||||.|||:.|||||.|||..:..||..|||.|..||..|.::..||.:|:||||||::| |
Zfish    81 IVLISRSEEKLHRVAKEIEDKYNQKTHVIQADFTEGHSIYSTITKQLEGLEIGILVNNVGMNYIG 145

  Fly   143 HPEYFLDCYKADPPFLRNIVAANIHSVTHMTALFLPGMISQRRGVIINVSSTAGVIPNPLLSVYS 207
            ....|||....|.. :..::..|..|||.|..:.||||:.:.:|:|||:||.||..|.|::|:||
Zfish   146 VLANFLDVPDPDQR-ITQVLNCNTLSVTQMCRVILPGMVERGKGLIINISSEAGYQPVPMVSLYS 209

  Fly   208 STKAFVNKFSDDLQTEYKEHGILIQSVQPGFVATNMSKIRKASVFAPSPETYVRSALSTLGIATQ 272
            :|||||..||..|..||:..||.:|.|.|..|:|||:.....:....|..::.|.||:|:|..|.
Zfish   210 ATKAFVTYFSLGLNAEYRSKGITVQCVAPFMVSTNMTHNVPVNPLVKSAASFARDALNTVGYTTY 274

  Fly   273 TAGYLPHALLQLVIHFTEAVFG-------------EQFARNI 301
            |:|.|.|||..:|:   ..||.             |:|||.|
Zfish   275 TSGCLTHALQHIVL---SIVFPGWLRLTSFCVQRMEKFARRI 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spideyNP_572420.1 PLN02780 8..321 CDD:166421 134/302 (44%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 116/236 (49%)
hsd20b2NP_001373557.1 17beta-HSD1_like_SDR_c 54..296 CDD:187614 118/245 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43899
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X484
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.