DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spidey and CG8888

DIOPT Version :9

Sequence 1:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster


Alignment Length:345 Identity:79/345 - (22%)
Similarity:134/345 - (38%) Gaps:77/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLGGLAIGIVG-FQVFRKVLPWIYANVVGPKVFGSSVDLSKMGEWAVVTGSTDGIGKAYAKELAR 74
            ||..|.|..:. |.||    .|.....||..:|...|.:|..|:..::||....:....||:|..
  Fly    57 LLHALDISSISTFAVF----VWFALATVGAVLFYHFVKVSASGKGVLITGCEAPLAWYLAKKLDD 117

  Fly    75 RGLKLVL-----ISRSLEKLNVVAKEIGDKYGVEVRVIDVDFTGGDEIYDKIREKTTGLNVG--- 131
            .|..:..     |..|.|     ||.:.:.....::::.:|.|....|.:..|..:..|..|   
  Fly   118 LGFTVYAGFNTPIEESDE-----AKILKEVTSGRMKLLHLDVTSEKTILEAARYVSQHLPHGAEG 177

  Fly   132 ---VLVNNVGISYGHPEYFLDCYKADPPF--LRNIVAANIHSVTHMTALFLPGMISQRRGVIINV 191
               |:.....|:.|..|:.        ||  ||..:..|:.....:|.:||| ::.:..|.::.:
  Fly   178 LWSVVHCAHWIALGELEWI--------PFAVLRKSLDLNLLGSARLTQIFLP-LVRRAHGRVVFL 233

  Fly   192 SSTAGVIPNPLLSVYSSTKAFVNKFSDDLQTEYKEHGILIQSVQPGFVA-----TNMSKIRKAS- 250
            :|....:|:|:..:..:|:|.|:.|:..|:.|.:..|:.:..|..|..|     .|.:::|..: 
  Fly   234 TSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEFAPGNGWLNETELRDQAK 298

  Fly   251 --------------------VFAPSPETYVRSALS---TLGI----ATQT---AGYLP---HALL 282
                                ....|.|.|.|.|..   ||.:    .|:|   |.|.|   ...|
  Fly   299 QMWNQLSSEQKKTYGEDYYEAAMTSVEKYSRQAADIQPTLRVLIDAVTRTFPMARYTPVTSSERL 363

  Fly   283 QLVI--HFT----EAVFGEQ 296
            |:.:  |..    |:::|||
  Fly   364 QIFLAEHLAPSLYESLYGEQ 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spideyNP_572420.1 PLN02780 8..321 CDD:166421 79/345 (23%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 61/289 (21%)
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 62/297 (21%)
adh_short 96..293 CDD:278532 45/210 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.