DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spidey and CG30491

DIOPT Version :9

Sequence 1:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster


Alignment Length:235 Identity:61/235 - (25%)
Similarity:97/235 - (41%) Gaps:53/235 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DLSKMGEWAVVTGSTDGIGKAYAKELARRGLKLVLISRSLEKLNVVAKEI----GDKYGVEVRVI 107
            :.::.|:..:|||:..||||...:|:|:||..:.:..|:|:|.....:||    .:|| |..|..
  Fly    40 ETNETGKVFIVTGANTGIGKETVREIAKRGGTVYMACRNLKKCEEAREEIVLETKNKY-VYCRQC 103

  Fly   108 DVDFTGGDEIYDKIRE-----KTTGLNVGVLVNNVGISYGHPEYFLDCYKADPPFLRNIVAANIH 167
            |:      ...:.||.     |....::.||:||.|:        :.|     |  |::.:..|.
  Fly   104 DL------ASQESIRHFVAAFKREQEHLHVLINNAGV--------MRC-----P--RSLTSDGIE 147

  Fly   168 ---SVTHM-----TALFLPGMISQRRGVIINVSS---TAGVIPNPLLS---------VYSSTKAF 212
               .|.||     |.|.|..:.......|:||||   |.|.|....|:         .||.:|..
  Fly   148 LQLGVNHMGHFLLTNLLLDLLKKSSPSRIVNVSSLAHTRGEINTGDLNSDKSYDEGKAYSQSKLA 212

  Fly   213 VNKFSDDLQTEYKEHGILIQSVQPGFVATNMSKIRKASVF 252
            ...|:.:|....:...:...::.||.|.|.:  ||....|
  Fly   213 NVLFTRELAKRLEGTNVTANALHPGVVDTEI--IRHMGFF 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spideyNP_572420.1 PLN02780 8..321 CDD:166421 61/235 (26%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 61/230 (27%)
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 61/232 (26%)
NADB_Rossmann 45..319 CDD:304358 61/230 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447530
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.