DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spidey and CG6012

DIOPT Version :9

Sequence 1:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster


Alignment Length:297 Identity:101/297 - (34%)
Similarity:163/297 - (54%) Gaps:28/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SQVLSLLGGLAIGIVGFQVFR---KVLPWIYANVVGPKVFGSSVDLSKMGEWAVVTGSTDGIGKA 67
            |..|:.:|..|:....::..|   |::...|.:...|.:      ..:.|:||.|||::|||||.
  Fly     6 SAFLTFVGVYALSSYLYEQLRTPYKLIKIRYFSGTRPTL------KERFGDWAAVTGASDGIGKE 64

  Fly    68 YAKELARRGLKLVLISRSLEKLNVVAKEIGD-KYGVEVRVIDVDFTGGDEIYDKIREKTTGLNVG 131
            |||||||:.:.:|||:|:.|||..|||||.| ..||:.:::..|||.|.::|:.|.::|..:.:.
  Fly    65 YAKELARQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTKGSQVYEHIEKETANIPIS 129

  Fly   132 VLVNNVGISYGHPEYFLDCYKADPPFLRNIVAANIHSVTHMTALFLPGM-ISQRRGVIINVSSTA 195
            :|||||||:  .|:..|   |.:....:||:..|:.:|:.::.:|...| .|:.:|.|:||.|..
  Fly   130 ILVNNVGIA--TPKSLL---KYNQEETQNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSGT 189

  Fly   196 GVIPNPLLSVYSSTKAFVNKFSDDLQTEYKEHGILIQSVQPGFVATNMS----KIRKASVFAPSP 256
            .:.|.|..:.|:::||:....:..|..|.|.:||.:|.:.|.||.|.::    :|.|..:..||.
  Fly   190 ELQPLPNGAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKGGLLIPSA 254

  Fly   257 ETYVRSALSTL-GIATQTAGYLPHALLQLVIHFTEAV 292
            ..|.:||::.| ....:|.|||.|       |...||
  Fly   255 SAYAKSAVNQLRDEVDETPGYLWH-------HVQNAV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spideyNP_572420.1 PLN02780 8..321 CDD:166421 100/295 (34%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 90/242 (37%)
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 93/248 (38%)
adh_short 51..243 CDD:278532 76/196 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447528
Domainoid 1 1.000 148 1.000 Domainoid score I2740
eggNOG 1 0.900 - - E1_COG0300
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D125652at50557
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43899
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.