DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spidey and firl

DIOPT Version :9

Sequence 1:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001033900.2 Gene:firl / 34627 FlyBaseID:FBgn0032405 Length:318 Species:Drosophila melanogaster


Alignment Length:220 Identity:60/220 - (27%)
Similarity:100/220 - (45%) Gaps:36/220 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FQVFRKVLPWIYANVVGPKVFGSSVDLSKMGEWAVVTGSTDGIGKAYAKELARRGLKLVLIS--- 83
            |:::.::|..::.::|...:.....|:|  ||..::||:..|||:..|...|..|..:|.:.   
  Fly    27 FELYVRILLELFVSLVQIVLPKKQKDVS--GEIVLITGTGHGIGRELALHYASLGSTVVCVDIDG 89

  Fly    84 ----RSLEKLNVVAK--EIGDKYGVEVRVIDVDFTGGDEI---YDKIREKTTGLNVG---VLVNN 136
                :::||    ||  .:|:.|.     ...|.:..||:   .|:|:.     :||   |||||
  Fly    90 KNNLQTVEK----AKRLNLGEVYS-----YSCDVSKRDEVTALADRIKS-----DVGCISVLVNN 140

  Fly   137 VGISYGHPEYFLDCYKADPPFLRNIVAANIHSVTHMTALFLPGMISQRRGVIINVSSTAGVIPNP 201
            |||...||     ..:.....::.:...|:.|.......|||.|..:.||.||.:||.||::...
  Fly   141 VGIMPTHP-----ILQQSAEEIQRVFDVNVFSQFWTIQAFLPHMQEKCRGHIICMSSIAGLVGIS 200

  Fly   202 LLSVYSSTKAFVNKFSDDLQTEYKE 226
            .|..|.:||..|....:.|..|.::
  Fly   201 NLVPYCATKFAVRGLMEALHAELRQ 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spideyNP_572420.1 PLN02780 8..321 CDD:166421 60/220 (27%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 55/190 (29%)
firlNP_001033900.2 adh_short 56..246 CDD:278532 54/189 (29%)
17beta-HSDXI-like_SDR_c 57..299 CDD:187598 53/188 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447522
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.