DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spidey and CG31809

DIOPT Version :9

Sequence 1:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster


Alignment Length:272 Identity:117/272 - (43%)
Similarity:167/272 - (61%) Gaps:20/272 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FQVFRKVL-PWIYANVVGPKVFGSSVDLSKMGEWAVVTGSTDGIGKAYAKELARRGLKLVLISRS 85
            |.:.:.|: |:...|:  ||...     .|.|.||||||:||||||.||:||||:||.|||:||.
  Fly    24 FSIIKSVVEPFFRPNL--PKTLA-----EKFGNWAVVTGATDGIGKEYARELARQGLNLVLVSRK 81

  Fly    86 LEKLNVVAKEIGDKYGVEVRVIDVDFTGGDEIYDKIREKTTGLNVGVLVNNVGISYGHPEYFLDC 150
            .|||..|..|||.:|.|:::.|..||..|.|:|..|.::..|:.||:||||||..  |....|| 
  Fly    82 EEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIEKELNGIEVGILVNNVGTI--HDPESLD- 143

  Fly   151 YKADPPFLRNIVAANIHSVTHMTALFLPGMISQRRGVIINVSSTAGVIPNPLLSVYSSTKAFVNK 215
             |.....|.:::..|:.|||.:|...||.|||:|:|.|:|:.|::.:.|:|.|:.|::||.||..
  Fly   144 -KVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTH 207

  Fly   216 FSDDLQTEYKEHGILIQSVQPGFVATNMS----KIRKASVFAPSPETYVRSALSTLGIATQTAGY 276
            |:..|:.|..||.|.:|.|.|.||||||:    |:|:..:..|:..:|.|||:.|||..::|.|:
  Fly   208 FTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFPNAYSYARSAVFTLGKTSETNGF 272

  Fly   277 ----LPHALLQL 284
                |.:||::|
  Fly   273 WVHGLQYALMKL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spideyNP_572420.1 PLN02780 8..321 CDD:166421 117/272 (43%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 110/241 (46%)
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 110/241 (46%)
DltE 50..302 CDD:223377 109/239 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447526
Domainoid 1 1.000 153 1.000 Domainoid score I1365
eggNOG 1 0.900 - - E1_COG0300
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I1260
Isobase 1 0.950 - 0.803099 Normalized mean entropy S1433
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D125652at50557
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 1 1.000 - - mtm1136
orthoMCL 1 0.900 - - OOG6_100431
Panther 1 1.100 - - P PTHR43899
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.