DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spidey and Hsd17b3

DIOPT Version :9

Sequence 1:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_032317.2 Gene:Hsd17b3 / 15487 MGIID:107177 Length:305 Species:Mus musculus


Alignment Length:316 Identity:117/316 - (37%)
Similarity:177/316 - (56%) Gaps:31/316 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSLLGGLAIGIVG-----------FQVFRKVLPWIYANVVGPKVFGSSVDLSKMGEWAVVTGSTD 62
            |.:..||.:|:|.           |..|.|.||              |..|..||:|||:||:.|
Mouse     4 LFIAAGLFVGLVCLVKCMRFSQHLFLRFCKALP--------------SSFLRSMGQWAVITGAGD 54

  Fly    63 GIGKAYAKELARRGLKLVLISRSLEKLNVVAKEIGDKYGVEVRVIDVDFTGGDEIYDKIREKTTG 127
            ||||||:.||||.||.:|||||:||||..:|:||....|..|:::..||| .::|||.|:|...|
Mouse    55 GIGKAYSFELARHGLNVVLISRTLEKLQTIAEEIERTTGSCVKIVQADFT-REDIYDHIKEHLEG 118

  Fly   128 LNVGVLVNNVGISYGHPEYFLDCYKADPPFLRNIVAANIHSVTHMTALFLPGMISQRRGVIINVS 192
            |.:|:||||||:.   |.:|...:.:.....:|::..||.||..||.|.|..|.|:|:|:|:|:|
Mouse   119 LEIGILVNNVGML---PSFFPSHFLSTSGESQNLIHCNITSVVKMTQLVLKHMESRRKGLILNIS 180

  Fly   193 STAGVIPNPLLSVYSSTKAFVNKFSDDLQTEYKEHGILIQSVQPGFVATNMSKIRKASVFAPSPE 257
            |.|.:.|.||.|:||::||||..||..|..||::.||:||.:.|..::|.|:|.....:...:.|
Mouse   181 SGAALRPWPLYSLYSASKAFVYTFSKALSVEYRDKGIIIQVLTPYSISTPMTKYLNNKMTKTADE 245

  Fly   258 TYVRSALSTLGIATQTAGYLPHALLQLVIH-FTEAVFGEQFARNIVMKNILGTRKR 312
             :|:.:|..:.|..::.|.|.|.::.:::: ....:|....|:..::.......||
Mouse   246 -FVKESLKYVTIGAESCGCLAHEIIAIILNRIPSRIFYSSTAQRFLLTRYSDYLKR 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spideyNP_572420.1 PLN02780 8..321 CDD:166421 117/316 (37%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 100/236 (42%)
Hsd17b3NP_032317.2 17beta-HSD1_like_SDR_c 44..280 CDD:187614 100/240 (42%)
adh_short 45..236 CDD:278532 92/194 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43899
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R721
SonicParanoid 1 1.000 - - X484
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.