DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spidey and C04F6.7

DIOPT Version :9

Sequence 1:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001379617.1 Gene:C04F6.7 / 13219936 WormBaseID:WBGene00195081 Length:447 Species:Caenorhabditis elegans


Alignment Length:179 Identity:36/179 - (20%)
Similarity:55/179 - (30%) Gaps:64/179 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QVFRKVLP-----------------WIYANVVGPKVFGSSVDLSKMG---EWAVVTGSTDGIGKA 67
            ::|.|||.                 |.|..:..|:..||.|..:.:|   :|..|  .|..|.:.
 Worm   273 ELFTKVLRDSHKSLGIDDFLCHGDLWFYNLMWIPRKSGSEVASNHLGSIIDWQNV--HTGNICED 335

  Fly    68 YAKELA-------RRGLKLVLISRSLEKLNVVAKEIGDKYGVEV-------------RVIDVDF- 111
            :...|.       ||..:...:.....:|...|.|.|.|..:.:             ..:.:.| 
 Worm   336 FCHMLTFCCDTEIRRQAENTFLPYYYNQLKAKAVEAGKKLNLTLNQFLRAYRRNFIAHALHLPFI 400

  Fly   112 --------TGGDEIYDKIREKTTGLNVGVLVNNV------GISYGHPEY 146
                    ...|||..|||.:       :|:..|      .|...|.||
 Worm   401 VSIMLCVKPADDEIVQKIRNQ-------MLIQKVLGAWEDAIQAMHEEY 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spideyNP_572420.1 PLN02780 8..321 CDD:166421 36/179 (20%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 26/133 (20%)
C04F6.7NP_001379617.1 CHK 184..366 CDD:214734 19/94 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.