DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spidey and Hsd17b3

DIOPT Version :9

Sequence 1:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_446459.1 Gene:Hsd17b3 / 117182 RGDID:621805 Length:306 Species:Rattus norvegicus


Alignment Length:285 Identity:116/285 - (40%)
Similarity:168/285 - (58%) Gaps:21/285 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FQVFRKVLPWIYANVVGPKVFGSSVDLSKMGEWAVVTGSTDGIGKAYAKELARRGLKLVLISRSL 86
            |..|.|.||..:              |..||:|||:||:.|||||||:.||||.||.:|||||:|
  Rat    28 FLSFCKALPGSF--------------LRSMGQWAVITGAGDGIGKAYSFELARHGLNVVLISRTL 78

  Fly    87 EKLNVVAKEIGDKYGVEVRVIDVDFTGGDEIYDKIREKTTGLNVGVLVNNVGISYG-HPEYFLDC 150
            |||.|:::||....|..|:|:..||| .::|||.|.|:..||.:||||||||:... .|.:||..
  Rat    79 EKLQVISEEIERTTGSRVKVVQADFT-REDIYDHIEEQLKGLEIGVLVNNVGMLPNLLPSHFLST 142

  Fly   151 YKADPPFLRNIVAANIHSVTHMTALFLPGMISQRRGVIINVSSTAGVIPNPLLSVYSSTKAFVNK 215
            ....    ::::..||.||..||.|.|..|.|:|||:|:|:||..||.|.||.|:||::||||..
  Rat   143 SGES----QSVIHCNITSVVKMTQLVLKHMESRRRGLILNISSGVGVRPWPLYSLYSASKAFVCT 203

  Fly   216 FSDDLQTEYKEHGILIQSVQPGFVATNMSKIRKASVFAPSPETYVRSALSTLGIATQTAGYLPHA 280
            ||..|..||::.||:||.:.|..|:|.|:|....|....:.:.:|:.:|..:.|..:|.|.|.|.
  Rat   204 FSKALNVEYRDKGIIIQVLTPYSVSTPMTKYLNTSRVTKTADEFVKESLKYVTIGAETCGCLAHE 268

  Fly   281 LLQLVIHFTEA-VFGEQFARNIVMK 304
            :|.::::...: :|.....:..::|
  Rat   269 ILAIILNLIPSRIFYSSTTQRFLLK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spideyNP_572420.1 PLN02780 8..321 CDD:166421 116/285 (41%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 107/236 (45%)
Hsd17b3NP_446459.1 17beta-HSD1_like_SDR_c 44..281 CDD:187614 107/241 (44%)
adh_short 45..236 CDD:278532 97/195 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43899
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X484
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.