DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spidey and hsdl1

DIOPT Version :9

Sequence 1:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_002937365.1 Gene:hsdl1 / 100489686 XenbaseID:XB-GENE-989915 Length:322 Species:Xenopus tropicalis


Alignment Length:284 Identity:94/284 - (33%)
Similarity:159/284 - (55%) Gaps:10/284 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENNSQVLSLLGGLAIGIVGFQVFRKVLPWIYANVVGPKVFGSSVDLSKM-GEWAVVTGSTDGIGK 66
            :::.:.|:::|.|.....|.::..:....|..::. |.:| |..:|.:. |.||||||:|.||.:
 Frog    19 QSHMEFLAVVGALYTAGKGLKLICQSYNLIRLHIT-PLLF-SRTNLGRQYGAWAVVTGATSGIAQ 81

  Fly    67 AYAKELARRGLKLVLISRSLEKLNVVAKEIGDKYGVEVRVIDVDFTGGDEIYDKIREKTTGLNVG 131
            |||:||||.|:.:||:..:.|||..::..|...:||....|:|||..|.|.|..|::....:.||
 Frog    82 AYAEELARCGMNVVLVDNNREKLQKMSDSITATHGVNTSFIEVDFCKGHEAYRPIKDALRHVEVG 146

  Fly   132 VLVNNVGISYGHPEYFLDCYKADPPFLRNIVAANIHSVTHMTALFLPGMISQRRGVIINVSSTAG 196
            :|||.||....:|:..::|.:..   |..|:..::.:.|.|..:.:|||..:|||.|:|||..:.
 Frog   147 ILVNCVGNFLEYPQSVIECPEEQ---LWKIIHVSVSAATIMAKIVVPGMAQRRRGAIVNVSFRSC 208

  Fly   197 VIPNPLLSVYSSTKAFVNKFSDDLQTEYKEHGILIQSVQPGFVATNMSKIRKAS----VFAPSPE 257
            ..||..:::|:..:.:::.|:.:||:|....||.:||:.|..||...:...:.|    ...||||
 Frog   209 CKPNFPMTMYTPCQLYMDGFTKELQSELSSKGIFVQSLTPLCVAKERTLHYRPSFRFPFLVPSPE 273

  Fly   258 TYVRSALSTLGIATQTAGYLPHAL 281
            .|.|.|:..||::.:|.||..|::
 Frog   274 VYARHAVQMLGVSHRTTGYWAHSM 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spideyNP_572420.1 PLN02780 8..321 CDD:166421 94/279 (34%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 85/234 (36%)
hsdl1XP_002937365.1 17beta-HSD1_like_SDR_c 67..309 CDD:187614 85/234 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.