DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and CD86

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_787058.5 Gene:CD86 / 942 HGNCID:1705 Length:329 Species:Homo sapiens


Alignment Length:169 Identity:33/169 - (19%)
Similarity:59/169 - (34%) Gaps:47/169 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LNISTQLSSSVYLHCRVNDLQGKTVS-----WMRRRGDDLTLITFGQHTY-SGDSRY--SLEFEE 138
            |.|....:.:..|.|:..:.|.:::|     |..:....|..:..|:..: |..|:|  ...|:.
Human    26 LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDS 90

  Fly   139 PNDWKLLIQFANERDEGPYECQVS-----------------------SHPPLVLL------VYLT 174
             :.|.|.:.....:|:|.|:|.:.                       |.|.:|.:      ||:.
Human    91 -DSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYIN 154

  Fly   175 IIVPHVEILDERGSATPEK----YYKAGSTIELQCVISK 209
            :....:     .|...|:|    .....||||...|:.|
Human   155 LTCSSI-----HGYPEPKKMSVLLRTKNSTIEYDGVMQK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 24/129 (19%)
Ig strand B 92..96 CDD:409353 1/3 (33%)
Ig strand C 105..109 CDD:409353 1/8 (13%)
Ig strand E 142..146 CDD:409353 2/3 (67%)
Ig strand F 156..161 CDD:409353 2/4 (50%)
Ig strand G 168..171 CDD:409353 1/8 (13%)
IG_like 191..279 CDD:214653 8/23 (35%)
Ig strand B 201..205 CDD:409473 2/3 (67%)
Ig strand C 214..220 CDD:409473
Ig strand E 248..252 CDD:409473
Ig strand F 262..267 CDD:409473
CD86NP_787058.5 IgV_CD86 26..133 CDD:409508 19/107 (18%)
FR1 26..40 CDD:409508 3/13 (23%)
Ig strand A 26..31 CDD:409508 2/4 (50%)
Ig strand B 34..40 CDD:409508 1/5 (20%)
CDR1 41..52 CDD:409508 1/10 (10%)
FR2 53..60 CDD:409508 1/6 (17%)
Ig strand C 53..59 CDD:409508 1/5 (20%)
CDR2 62..82 CDD:409508 4/19 (21%)
Ig strand C' 64..69 CDD:409508 1/4 (25%)
Ig strand C' 72..74 CDD:409508 0/1 (0%)
FR3 83..115 CDD:409508 7/32 (22%)
Ig strand D 85..89 CDD:409508 0/3 (0%)
Ig strand E 93..99 CDD:409508 2/5 (40%)
Ig strand F 106..114 CDD:409508 3/7 (43%)
CDR3 116..118 CDD:409508 0/1 (0%)
FR4 119..133 CDD:409508 0/13 (0%)
Ig strand G 120..133 CDD:409508 0/12 (0%)
Ig 136..221 CDD:472250 14/58 (24%)
Ig strand B 152..157 CDD:409505 1/4 (25%)
Ig strand C 167..172 CDD:409505 1/4 (25%)
Ig strand E 201..205 CDD:409505
Ig strand F 215..220 CDD:409505
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.