Sequence 1: | NP_001245573.1 | Gene: | dpr14 / 31702 | FlyBaseID: | FBgn0029974 | Length: | 340 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001352835.1 | Gene: | PAPLN / 89932 | HGNCID: | 19262 | Length: | 1278 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 44/200 - (22%) |
---|---|---|---|
Similarity: | 60/200 - (30%) | Gaps: | 84/200 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 92 VYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQFANERDEGP 156
Fly 157 YEC---------------------QVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGST 200
Fly 201 IELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSR-----LYIANANRQDT 260
Fly 261 GNYTC 265 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr14 | NP_001245573.1 | IG_like | 83..163 | CDD:214653 | 16/91 (18%) |
Ig | 84..169 | CDD:299845 | 19/97 (20%) | ||
IG_like | 191..279 | CDD:214653 | 21/79 (27%) | ||
Ig | 201..274 | CDD:143165 | 19/69 (28%) | ||
PAPLN | NP_001352835.1 | TSP1 | 29..80 | CDD:214559 | |
ADAM_spacer1 | 183..298 | CDD:310520 | |||
TSP1 | 308..361 | CDD:214559 | |||
TSP1 | 369..424 | CDD:214559 | |||
TSP1 | 424..481 | CDD:214559 | |||
TSP1 | 488..539 | CDD:214559 | |||
Kunitz_BPTI | 753..805 | CDD:278443 | |||
Papilin_u7 | 814..905 | CDD:318767 | |||
Ig | 914..>978 | CDD:325142 | |||
I-set | 1049..1119 | CDD:254352 | 16/73 (22%) | ||
IG | 1139..1219 | CDD:214652 | 26/105 (25%) | ||
PLAC | 1235..1267 | CDD:312271 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |