DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and dpr21

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:281 Identity:97/281 - (34%)
Similarity:152/281 - (54%) Gaps:23/281 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DTFPKNFWQEFSSPFTDTPEDEELEVTETTTHEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQ 102
            :|.|::|.:..:  .||.....|..|......:..|:| |...|.|:::.:..:.:|:||:.:|.
  Fly    18 ETCPQHFRENVT--VTDLYLISENIVPMKRVLDRGPYF-DTSATKNVTSLVGITGHLNCRIKNLG 79

  Fly   103 GKTVSWMRRRGDDLTLITFGQHTYSGDSRY-SLEFEEPNDWKLLIQFANERDEGPYECQVSSHPP 166
            .|||||:|.|  ||.|:|..:.||:.|.|: |:..::..||.|.|:|...||.|.||||||:.||
  Fly    80 NKTVSWIRHR--DLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTTPP 142

  Fly   167 LVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTS 231
            :...:..:::.|...||     ..||.|...|||:.|.|||..:|.|...:.|.|..:.:|||:.
  Fly   143 VGYTMVFSVVEPITSIL-----GGPEIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSP 202

  Fly   232 RGGISV---KTDMLPGRALSRLYIANANRQDTGNYTCMLGNEITETVVVHVLNGEEPAAMQHANG 293
            |||:||   |.|:    ..|.|.|..|:..|:|.|||:..|..:::|.||:|.|:.|||:|    
  Fly   203 RGGVSVITEKGDI----TTSYLLIQRASIADSGQYTCLPSNANSKSVNVHILKGDHPAAVQ---- 259

  Fly   294 SRQKANASTMVVLFLVYVCIS 314
             :.....|.::.|..:.:|::
  Fly   260 -KSHLLVSELLSLCFLQICLN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 34/80 (43%)
Ig 84..169 CDD:299845 36/85 (42%)
IG_like 191..279 CDD:214653 36/90 (40%)
Ig 201..274 CDD:143165 28/75 (37%)
dpr21NP_001163838.2 Ig 71..149 CDD:299845 36/79 (46%)
IG_like 71..140 CDD:214653 34/70 (49%)
IG_like 162..249 CDD:214653 36/90 (40%)
IGc2 169..242 CDD:197706 31/76 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444724
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.990

Return to query results.
Submit another query.