DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and KIRREL3

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_011541328.1 Gene:KIRREL3 / 84623 HGNCID:23204 Length:809 Species:Homo sapiens


Alignment Length:324 Identity:68/324 - (20%)
Similarity:111/324 - (34%) Gaps:99/324 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 EVTETTTHEPFPFFADPYT--------TLNIS-------------------TQLSSSVYLHCRVN 99
            ||..||.  .:.:|::|.:        :.|:|                   ..|.|.....|...
Human   303 EVYRTTV--DYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTTEPQSLLVDLGSDAIFSCAWT 365

  Fly   100 DLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQVSSH 164
            .....|:.|| :||..:.|                    .|:..|.::...:.|.|.|.|:.   
Human   366 GNPSLTIVWM-KRGSGVVL--------------------SNEKTLTLKSVRQEDAGKYVCRA--- 406

  Fly   165 PPLVLLVYLTIIVPHV-----EI-LDERG----SATPEKYYKAGSTIELQCVISKIPHPSSYITW 219
                       :||.|     |: |...|    |:|..::...|...:::|.|...| |...|.|
Human   407 -----------VVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTP-PPDRIAW 459

  Fly   220 RHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGN-YTCMLGNEI-TETVVVHVLNG 282
            .....:|...|| |..:|:|.......:|.|.|:|..|.|... |.|...|.. ::|.::.:  .
Human   460 SWKENVLESGTS-GRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRL--K 521

  Fly   283 EEPAAMQHANGSRQKANASTMVVL----------FLV-------YVCISGSISVAGMNRGLGLG 329
            |:.:.|:  :|:..:|.:..|.|:          |||       :.|.....|..|.:...|.|
Human   522 EQGSEMK--SGAGLEAESVPMAVIIGVAVGAGVAFLVLMATIVAFCCARSQRSTGGRSGISGRG 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 17/98 (17%)
Ig 84..169 CDD:299845 16/103 (16%)
IG_like 191..279 CDD:214653 23/89 (26%)
Ig 201..274 CDD:143165 21/74 (28%)
KIRREL3XP_011541328.1 Ig 58..149 CDD:299845
IG_like 60..149 CDD:214653
I-set 156..249 CDD:254352
Ig2_KIRREL3-like 171..252 CDD:143236
Ig_2 260..337 CDD:290606 8/35 (23%)
I-set 341..422 CDD:254352 20/115 (17%)
IGc2 355..406 CDD:197706 14/71 (20%)
Ig5_KIRREL3 424..521 CDD:143306 26/100 (26%)
IG_like 432..521 CDD:214653 23/92 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.